BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10l20 (706 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 23 2.1 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 23 2.8 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 22 4.9 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 22 4.9 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 6/30 (20%) Frame = +1 Query: 562 VTLLEYDRRFEVHGP------DYIFYDYNN 633 + + +DR F + G DY FYDY+N Sbjct: 7 IKYINFDRFFFIEGMTNVLDFDYYFYDYSN 36 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 23.0 bits (47), Expect = 2.8 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 604 PDYIFYDYNNPKEVPPDVHHSYDLVVADPPFLS 702 PDYIF + ++ +PP+ S L DP FL+ Sbjct: 50 PDYIFEEGDDYVTLPPEFFDS--LWQPDPYFLN 80 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/26 (30%), Positives = 12/26 (46%) Frame = +1 Query: 619 YDYNNPKEVPPDVHHSYDLVVADPPF 696 +D+ N + P SY + DP F Sbjct: 395 FDFQNKNNLIPSALQSYSTSMRDPAF 420 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/26 (30%), Positives = 12/26 (46%) Frame = +1 Query: 619 YDYNNPKEVPPDVHHSYDLVVADPPF 696 +D+ N + P SY + DP F Sbjct: 395 FDFQNKNNLIPSALQSYSTSMRDPAF 420 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,032 Number of Sequences: 438 Number of extensions: 4154 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -