BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10l19 (794 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g28250.1 68418.m03425 Ulp1 protease family protein contains P... 30 2.0 At4g29560.1 68417.m04215 expressed protein 30 2.0 At2g47680.1 68415.m05955 zinc finger (CCCH type) helicase family... 29 2.7 At4g11070.1 68417.m01798 WRKY family transcription factor other ... 29 3.6 At4g31370.1 68417.m04448 fasciclin-like arabinogalactan family p... 28 8.2 >At5g28250.1 68418.m03425 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 939 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 527 ASKRKNTTRSDDYESNKQPDYDMDL-SDFSITEVEATQYLTLL 652 A + N T S D ESN P Y L SDF++ + Q ++ + Sbjct: 408 ADESNNETASGDQESNPPPSYSRPLHSDFNLPSFQGDQAISTI 450 >At4g29560.1 68417.m04215 expressed protein Length = 493 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/57 (26%), Positives = 26/57 (45%) Frame = -3 Query: 465 VSNSRLSILTIDGLSTEHNSTPSFSVNKMGSPGMLVSLVSVTTNSILLVKLVTSGWN 295 +SN L D + +S P + K+GS G ++ + V+ + + LV WN Sbjct: 135 ISNLDLDSADEDSMKQVFDSVPDWLSEKLGSAGTILPWLPVSCDDVDSEMLVVDSWN 191 >At2g47680.1 68415.m05955 zinc finger (CCCH type) helicase family protein similar to SP|Q28141 ATP-dependent RNA helicase A (Nuclear DNA helicase II) (DEAD-box protein 9) {Bos taurus}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 1015 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -2 Query: 421 DGAQQHPLVFCKQNGFSGNACVISFSDHKLHFVSKISNKW 302 DG+ PL+ G C++ F D +HF S I+N++ Sbjct: 799 DGSSTSPLLDLFPTSSEG--CILVFDDSDMHFTSSIANRY 836 >At4g11070.1 68417.m01798 WRKY family transcription factor other putative proteins, Arabidopsis thaliana Length = 313 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -3 Query: 465 VSNSRLSILTIDGLSTEHNSTPSFSVNKMGSPGMLV-SLVSVTTN 334 VS+ + +IL ++G +T+HN T + + + PG + S S+T N Sbjct: 53 VSSFKKAILMLNGSTTQHNPTIELAPDPLAHPGKVPGSPASITGN 97 >At4g31370.1 68417.m04448 fasciclin-like arabinogalactan family protein similar to fasciclin-like arabinogalactan-protein 1 [Arabidopsis thaliana] gi|13377776|gb|AAK20857 Length = 278 Score = 27.9 bits (59), Expect = 8.2 Identities = 22/76 (28%), Positives = 40/76 (52%), Gaps = 5/76 (6%) Frame = +2 Query: 8 IKMKRVKC-NKVRTVTEIVNSDEKIQKTYELAEFDLKNLSS----LESYETLKIKLALSK 172 IK K + +K +T+T + S++ I +E +L+N+ L+ Y+ LK++ + + Sbjct: 45 IKTKLIAAIDKYQTITVLAVSNDAISSITNRSEVELRNILMTHVILDYYDELKLQ-GMRE 103 Query: 173 YMAMLSTLEMTQPLLE 220 ML+TL T L E Sbjct: 104 KSIMLTTLYQTTGLGE 119 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,331,909 Number of Sequences: 28952 Number of extensions: 320848 Number of successful extensions: 892 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 875 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 892 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1794809600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -