BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10l18 (251 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 26 0.24 AY278448-1|AAP37005.1| 147|Anopheles gambiae microsomal glutath... 24 0.74 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 21 9.1 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 21 9.1 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 25.8 bits (54), Expect = 0.24 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 97 KIIERSIKNYGTFWPSRGAETQDSKTLQQTRRQ 195 ++ ERS +WPSRG E + T+ T Q Sbjct: 775 RLEERSRIKCTMYWPSRGTEVYGAMTVTITETQ 807 >AY278448-1|AAP37005.1| 147|Anopheles gambiae microsomal glutathione transferase GSTMIC3protein. Length = 147 Score = 24.2 bits (50), Expect = 0.74 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = -2 Query: 244 FVYRYNLLQINFTLNQFVFVFVVRSSNLVFQPLGMAKMCRSF*W 113 F+Y + + N F V VVR S+ VF L R W Sbjct: 85 FLYMFTNPSVTVATNLFRLVAVVRISHTVFHVLVPVHKFRGMSW 128 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 20.6 bits (41), Expect = 9.1 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 91 HSECDKRGHDKQQDNQ 44 HS+ DK+ HD +Q Q Sbjct: 3195 HSQIDKQFHDLKQTVQ 3210 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 20.6 bits (41), Expect = 9.1 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 91 HSECDKRGHDKQQDNQ 44 HS+ DK+ HD +Q Q Sbjct: 3198 HSQIDKQFHDLKQTVQ 3213 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 290,764 Number of Sequences: 2352 Number of extensions: 5139 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 563,979 effective HSP length: 53 effective length of database: 439,323 effective search space used: 13179690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -