BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10l15 (778 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein Pss1|Sch... 26 5.2 SPBC839.03c |||neddylation protein Dcn1|Schizosaccharomyces pomb... 26 6.9 SPAC1296.06 |||NADPH cytochrome reductase|Schizosaccharomyces po... 25 9.2 SPAC19D5.07 |uga1||4-aminobutyrate aminotransferase |Schizosacch... 25 9.2 SPCC965.04c |||mitochondrial inner membrane i-AAA protease compl... 25 9.2 >SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein Pss1|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 26.2 bits (55), Expect = 5.2 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +1 Query: 175 MAAVDMLQTINTTASQTAASLLINDITPNKTESLKIL 285 +AA + + Q A LIND+ PNK L I+ Sbjct: 447 LAAYSKEAQLPGSIKQNIAQYLINDVVPNKDGDLSIV 483 >SPBC839.03c |||neddylation protein Dcn1|Schizosaccharomyces pombe|chr 2|||Manual Length = 251 Score = 25.8 bits (54), Expect = 6.9 Identities = 14/54 (25%), Positives = 28/54 (51%) Frame = +2 Query: 443 SSVTMSAIALYLEINKLRLKIDEPMQLAIWPQIFPLLCDEHQNVQLNTDVLINF 604 S+ ++ + L ++ + D +Q AI+ +PL CD+ + L+T + I F Sbjct: 119 STTSLDQLKLAIKEKVQVWRSDASLQKAIYIYTYPLACDKGKKT-LSTSIAIEF 171 >SPAC1296.06 |||NADPH cytochrome reductase|Schizosaccharomyces pombe|chr 1|||Manual Length = 558 Score = 25.4 bits (53), Expect = 9.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 551 LCDEHQNVQLNTDVLINFI 607 +CD H+N N D+L F+ Sbjct: 387 ICDLHENTSFNIDILPGFL 405 >SPAC19D5.07 |uga1||4-aminobutyrate aminotransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 474 Score = 25.4 bits (53), Expect = 9.2 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 302 ERAICWNRCKPTRPKLS*IESKRSTC*TFWGAFTTTRSK 418 E C N P P+++ + + S +G+ +TTRSK Sbjct: 172 ENESCLNNAAPGSPEVAVLSFRHSFHGRLFGSLSTTRSK 210 >SPCC965.04c |||mitochondrial inner membrane i-AAA protease complex subunit Yme1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 709 Score = 25.4 bits (53), Expect = 9.2 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -1 Query: 94 YHRYHLLKQSWLSSISRDISLS 29 Y++ L K+SW S+S +ISLS Sbjct: 107 YYQEALRKKSWSRSLSNNISLS 128 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,891,725 Number of Sequences: 5004 Number of extensions: 54838 Number of successful extensions: 162 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 375345278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -