BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10l12 (657 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g09610.1 68414.m01078 expressed protein contains Pfam profile... 30 1.2 At1g02110.1 68414.m00137 proline-rich family protein contains pr... 30 1.6 >At1g09610.1 68414.m01078 expressed protein contains Pfam profile PF04669: Protein of unknown function (DUF579) Length = 282 Score = 30.3 bits (65), Expect = 1.2 Identities = 10/45 (22%), Positives = 23/45 (51%) Frame = +1 Query: 250 YNEKMPPRAKKLFVEAFTKYHKMNGGDEDIAMHKARKALEEKYVK 384 Y ++ P R ++ ++ GG+ D+ +H + +E+K+ K Sbjct: 201 YYDEAPGRMTAIYTAGMMARNRKQGGETDVFVHDVNREIEDKFSK 245 >At1g02110.1 68414.m00137 proline-rich family protein contains proline-rich domain, INTERPRO:IPR000694 Length = 679 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = -2 Query: 377 YFSSSAFLALCIAMSSSPPFIL*YFVNASTNNFLARGGIFSL 252 Y SSS F L + +S PP + Y ++AST N +GG+ SL Sbjct: 316 YHSSSVFSNLSASWTSKPPLAVKYKLDASTLND-EQGGLKSL 356 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,961,167 Number of Sequences: 28952 Number of extensions: 176466 Number of successful extensions: 489 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 489 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1373722560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -