BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10l11 (539 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g26880.1 68414.m03278 60S ribosomal protein L34 (RPL34A) iden... 119 1e-27 At1g69620.1 68414.m08008 60S ribosomal protein L34 (RPL34B) simi... 117 4e-27 At3g28900.1 68416.m03607 60S ribosomal protein L34 (RPL34C) simi... 116 8e-27 At3g56240.1 68416.m06250 copper homeostasis factor / copper chap... 28 4.6 At2g36760.1 68415.m04509 UDP-glucoronosyl/UDP-glucosyl transfera... 28 4.6 At1g48740.1 68414.m05454 expressed protein 28 4.6 At3g55290.2 68416.m06141 short-chain dehydrogenase/reductase (SD... 27 6.1 At3g55290.1 68416.m06140 short-chain dehydrogenase/reductase (SD... 27 6.1 At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly id... 27 6.1 At1g62610.2 68414.m07064 short-chain dehydrogenase/reductase (SD... 27 6.1 At1g62610.1 68414.m07063 short-chain dehydrogenase/reductase (SD... 27 6.1 >At1g26880.1 68414.m03278 60S ribosomal protein L34 (RPL34A) identical to GB:Q42351, location of EST 105E2T7, gb|T22624 Length = 120 Score = 119 bits (287), Expect = 1e-27 Identities = 60/104 (57%), Positives = 74/104 (71%), Gaps = 2/104 (1%) Frame = +1 Query: 130 MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 309 MVQRL +R R SY TKSNQ RIV+TPGG+LVYQ KK P+C +++GI RP+ Sbjct: 1 MVQRLVYRSRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPS 60 Query: 310 E--RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 435 E RSRL ++TV R YGGVL V++RI+RAFL+EEQKIVK Sbjct: 61 EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAFLVEEQKIVK 104 >At1g69620.1 68414.m08008 60S ribosomal protein L34 (RPL34B) similar to SP:Q42351 from [Arabidopsis thaliana] Length = 119 Score = 117 bits (282), Expect = 4e-27 Identities = 59/104 (56%), Positives = 72/104 (69%), Gaps = 2/104 (1%) Frame = +1 Query: 130 MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 309 MVQRL +R R SY TKSNQ RIV+TPGG+L YQ KK P+C +++GI RP Sbjct: 1 MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTKKRASGPKCPVTGKRIQGIPHLRPT 60 Query: 310 E--RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 435 E RSRL ++TV R YGGVL V++RI+RAFL+EEQKIVK Sbjct: 61 EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAFLVEEQKIVK 104 >At3g28900.1 68416.m03607 60S ribosomal protein L34 (RPL34C) similar to 60S ribosomal protein L34 GB:P41098 [Nicotiana tabacum] Length = 120 Score = 116 bits (280), Expect = 8e-27 Identities = 60/104 (57%), Positives = 72/104 (69%), Gaps = 2/104 (1%) Frame = +1 Query: 130 MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 309 MVQRL +R R SY TKSNQ RIV+TPGG+L YQ K P+C +++GI RPA Sbjct: 1 MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTNKRASGPKCPVTGKRIQGIPHLRPA 60 Query: 310 E--RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 435 E RSRL ++TV R YGGVL V++RIVRAFL+EEQKIVK Sbjct: 61 EYKRSRLARNERTVNRAYGGVLSGVAVRERIVRAFLVEEQKIVK 104 >At3g56240.1 68416.m06250 copper homeostasis factor / copper chaperone (CCH) (ATX1) identical to gi:3168840 Pfam profile PF00403: Heavy-metal-associated domain Length = 121 Score = 27.9 bits (59), Expect = 4.6 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 183 SKKNSKDTGWPLGLSVCQKAQEDPKVWSVQE 275 SK K + WP+ KA+ DPKV +V E Sbjct: 58 SKTGKKTSYWPVEAEAEPKAEADPKVETVTE 88 >At2g36760.1 68415.m04509 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 496 Score = 27.9 bits (59), Expect = 4.6 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 320 RERSAGLAGWIPRSLLLH*PHLGIFLGFLTY 228 +ERS + GW P+ L+L P +G GFLT+ Sbjct: 347 KERSLLIKGWSPQMLILSHPAVG---GFLTH 374 >At1g48740.1 68414.m05454 expressed protein Length = 393 Score = 27.9 bits (59), Expect = 4.6 Identities = 14/29 (48%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = +1 Query: 145 TFRRRLSYNTKSNQRRIVRTP-GGRLVYQ 228 +FR+ +S NTK + RRI+ P G LV+Q Sbjct: 130 SFRKAISENTKESFRRIISEPFPGVLVFQ 158 >At3g55290.2 68416.m06141 short-chain dehydrogenase/reductase (SDR) family protein contains similarity to 3-oxoacyl-[acyl-carrier protein] reductase SP:P51831 from [Bacillus subtilis] Length = 279 Score = 27.5 bits (58), Expect = 6.1 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -3 Query: 291 DTTEFALALTTPWDLLGLFDILINQAATRCPYYSSL 184 D A+ WD+ G D LIN A R SSL Sbjct: 83 DAATIQKAVREAWDIFGKIDALINNAGIRGNVKSSL 118 >At3g55290.1 68416.m06140 short-chain dehydrogenase/reductase (SDR) family protein contains similarity to 3-oxoacyl-[acyl-carrier protein] reductase SP:P51831 from [Bacillus subtilis] Length = 280 Score = 27.5 bits (58), Expect = 6.1 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -3 Query: 291 DTTEFALALTTPWDLLGLFDILINQAATRCPYYSSL 184 D A+ WD+ G D LIN A R SSL Sbjct: 84 DAATIQKAVREAWDIFGKIDALINNAGIRGNVKSSL 119 >At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly identical to auxin transport protein; BIG [Arabidopsis thaliana] GI:21779966; contains Pfam profiles PF02207: Putative zinc finger in N-recognin, PF00569: Zinc finger ZZ type Length = 5098 Score = 27.5 bits (58), Expect = 6.1 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = -3 Query: 336 LTVAKTRTFSRS--SWLDTTEFALALTTPWDLLGLFDILINQAATRCPYY 193 L V + FS+ SWLD A L +D++G+ ++++ T+C + Sbjct: 5041 LNVKEMIGFSKELISWLDEINSATDLQEAFDIVGVLADVLSEGVTQCDQF 5090 >At1g62610.2 68414.m07064 short-chain dehydrogenase/reductase (SDR) family protein contains similarity to 3-oxoacyl-[acyl-carrier protein] reductase SP:P51831 from [Bacillus subtilis] Length = 276 Score = 27.5 bits (58), Expect = 6.1 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 291 DTTEFALALTTPWDLLGLFDILINQAATRCPYYSSL 184 D A+ W++ G D+LIN A R SSL Sbjct: 79 DADTIRKAVKEAWEIFGTIDVLINNAGIRGNVKSSL 114 >At1g62610.1 68414.m07063 short-chain dehydrogenase/reductase (SDR) family protein contains similarity to 3-oxoacyl-[acyl-carrier protein] reductase SP:P51831 from [Bacillus subtilis] Length = 277 Score = 27.5 bits (58), Expect = 6.1 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 291 DTTEFALALTTPWDLLGLFDILINQAATRCPYYSSL 184 D A+ W++ G D+LIN A R SSL Sbjct: 80 DADTIRKAVKEAWEIFGTIDVLINNAGIRGNVKSSL 115 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,132,061 Number of Sequences: 28952 Number of extensions: 203342 Number of successful extensions: 449 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1003808112 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -