BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10l07 (697 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28921| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_6907| Best HMM Match : PAN (HMM E-Value=0.019) 33 0.29 SB_29300| Best HMM Match : GFO_IDH_MocA (HMM E-Value=2.1e-17) 33 0.29 SB_1834| Best HMM Match : efhand (HMM E-Value=1e-06) 32 0.39 SB_22681| Best HMM Match : PAN (HMM E-Value=0.0027) 30 1.6 SB_18837| Best HMM Match : Extensin_2 (HMM E-Value=1.7) 30 1.6 SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_12271| Best HMM Match : DUF1079 (HMM E-Value=1.2) 29 2.7 SB_43252| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_28538| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_34658| Best HMM Match : SUI1 (HMM E-Value=1e-06) 28 8.3 SB_12951| Best HMM Match : Radial_spoke_3 (HMM E-Value=0) 28 8.3 >SB_28921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = +3 Query: 519 VPGPITEKRSLFLAIKWLLETTDEKE--RTVHFPEQFAWELLEASNN 653 VP P+ R F AIKW+++ ++ + ++ A ELL+A NN Sbjct: 1 VPSPLNPIRRRFFAIKWIIDAARDQSGPKNARMHKKLAKELLDAYNN 47 >SB_6907| Best HMM Match : PAN (HMM E-Value=0.019) Length = 324 Score = 32.7 bits (71), Expect = 0.29 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 176 SSETHCRFGFEEPSNCTCEATY 241 SS CR G+E+P CTC+ Y Sbjct: 130 SSHRACRIGYEDPFRCTCQRNY 151 >SB_29300| Best HMM Match : GFO_IDH_MocA (HMM E-Value=2.1e-17) Length = 634 Score = 32.7 bits (71), Expect = 0.29 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 176 SSETHCRFGFEEPSNCTCEATY 241 SS CR G+E+P CTC+ Y Sbjct: 433 SSHRACRIGYEDPFRCTCQMNY 454 >SB_1834| Best HMM Match : efhand (HMM E-Value=1e-06) Length = 659 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +3 Query: 189 IADSDLKNRATVPVKPPTVSETSSVYFDPLVNKVINHVMEK 311 ++D K+RA P KP + SSV D L+ ++ +HV+ K Sbjct: 220 LSDKMNKDRAQTPPKPSPPLDLSSVDLDELIQRIRHHVLVK 260 >SB_22681| Best HMM Match : PAN (HMM E-Value=0.0027) Length = 329 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 191 CRFGFEEPSNCTCEATY 241 CR G+EEP CTC Y Sbjct: 143 CRIGYEEPYRCTCGKNY 159 >SB_18837| Best HMM Match : Extensin_2 (HMM E-Value=1.7) Length = 626 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -1 Query: 553 NNDLFSVIGPGTWYVIPPLLMGCNCNNGLQ 464 N F + PG WY PP L C+ NG Q Sbjct: 85 NRSSFKTLSPGEWYTEPP-LGSCHRGNGKQ 113 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/57 (28%), Positives = 26/57 (45%) Frame = -1 Query: 553 NNDLFSVIGPGTWYVIPPLLMGCNCNNGLQFSTALYKISLGFNSILAFSSGVEAKWY 383 N F + PG WY PP C+ NG+Q + ++ G + +F + +WY Sbjct: 326 NKSSFRTLSPGEWYTEPP-SGPCHRGNGIQ-NLLQDPVTGGMVNRTSFRTLSPGEWY 380 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -1 Query: 553 NNDLFSVIGPGTWYVIPPLLMGCNCNNGLQ 464 N F + PG WY PP C+ NG+Q Sbjct: 490 NRSSFRTLSPGEWYTEPP-SGPCHRGNGIQ 518 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -1 Query: 553 NNDLFSVIGPGTWYVIPPLLMGCNCNNGLQ 464 N F + PG WY PP C+ NG+Q Sbjct: 367 NRTSFRTLSPGEWYTEPP-SGPCHRGNGIQ 395 >SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1789 Score = 29.9 bits (64), Expect = 2.1 Identities = 19/71 (26%), Positives = 35/71 (49%) Frame = +3 Query: 279 VNKVINHVMEKGNKRLARQLVEKAFENIKRKQIERYHLASTPEEKAKIELNPKDILYKAV 458 +N+++NH E +K++ KA + +K + TPEE++K ++ P + Sbjct: 565 INRIMNH-REGYDKKI------KAKKGKNKKSKKTLPTGDTPEEESKPDIEPAQPIPTPQ 617 Query: 459 ENCKPLLQLQP 491 NCK + QP Sbjct: 618 VNCKERYEKQP 628 >SB_12271| Best HMM Match : DUF1079 (HMM E-Value=1.2) Length = 1716 Score = 29.5 bits (63), Expect = 2.7 Identities = 25/88 (28%), Positives = 40/88 (45%), Gaps = 1/88 (1%) Frame = +3 Query: 192 ADSDLKNRATVPVKPPTVSETSSVYFDPLVNKVINHVMEKGNKRLARQLVEKAFENIKRK 371 A SDL+ RAT ++ + S++ +P N V H L++ + Sbjct: 178 ATSDLQKRATELLEKSETTLDSTISTEPFPNLVKPH------------LIQAPLKQTSVS 225 Query: 372 QIERYHLASTPEEKAKIELNPK-DILYK 452 Q E + A P K K ++NP+ DILY+ Sbjct: 226 QPETHIAAPNPSYKQKRDINPENDILYQ 253 >SB_43252| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 699 Score = 28.7 bits (61), Expect = 4.8 Identities = 20/39 (51%), Positives = 24/39 (61%) Frame = +3 Query: 264 YFDPLVNKVINHVMEKGNKRLARQLVEKAFENIKRKQIE 380 YFDPL KV++ M N LARQ ++A E IKR Q E Sbjct: 503 YFDPLKTKVVHFSMNPSN--LARQ--QRA-EEIKRLQDE 536 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +3 Query: 339 VEKAFENIKRKQIERYHLASTPEEKAKI 422 +++AFE ++ + + + +A T EEKAKI Sbjct: 22 LQEAFEKFRKSRQKEFKIAKTMEEKAKI 49 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 28.3 bits (60), Expect = 6.3 Identities = 26/90 (28%), Positives = 37/90 (41%), Gaps = 7/90 (7%) Frame = +3 Query: 195 DSDLKNRATVPVKPPTVSETSSVYFDPLVNKVINHVMEKGNKRLARQLVEKAFENIKRKQ 374 D + A+ + T E D K ++ + +RL QL E N+K + Sbjct: 1872 DDESDEPASEEAEEKTKEEKLKSMLDSSKLKTEAKILREETERLKAQLEETM--NLKEEL 1929 Query: 375 IERYHLAS-------TPEEKAKIELNPKDI 443 ++ H A T EEKAKIE KDI Sbjct: 1930 QDKLHTAEHELFEARTSEEKAKIEHRDKDI 1959 >SB_28538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 28.3 bits (60), Expect = 6.3 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = +3 Query: 3 IKKK*KTMSNVLIFFYRRLKNSSFNSLTRTLSKLQIRNYAKATSFP 140 IKK+ KT++N+LIF N + LT TL ++ Y + S+P Sbjct: 47 IKKRLKTLTNILIF------NLAVAELTNTLCLPLVQTYLELKSWP 86 >SB_34658| Best HMM Match : SUI1 (HMM E-Value=1e-06) Length = 798 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/48 (22%), Positives = 24/48 (50%) Frame = +3 Query: 171 EDQVKLIADSDLKNRATVPVKPPTVSETSSVYFDPLVNKVINHVMEKG 314 ED VK++A + + P ++S+ P++N+++N + G Sbjct: 537 EDDVKILAHKPISKSCNLDPLPTSLSKGCFSTLLPIINRIVNASLSSG 584 >SB_12951| Best HMM Match : Radial_spoke_3 (HMM E-Value=0) Length = 374 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +3 Query: 264 YFDPLVNKVINHVMEKGNKRLARQLVEKAFENIKRKQIERYHLASTPEEKAKIE 425 ++DP+ +I HV+ K RQ V + R +E+ +A E+K KIE Sbjct: 278 FYDPVERAIIRHVVTK------RQQVYGKLDEELRLSMEKEIMARAAEQKKKIE 325 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,008,929 Number of Sequences: 59808 Number of extensions: 423343 Number of successful extensions: 1252 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1251 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -