BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10k23 (426 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40445| Best HMM Match : rve (HMM E-Value=0.0008) 29 2.1 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 29 2.1 SB_26245| Best HMM Match : Homeobox (HMM E-Value=1.7e-32) 27 4.9 SB_700| Best HMM Match : Fer4 (HMM E-Value=0.04) 27 4.9 SB_54763| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_5783| Best HMM Match : PIR (HMM E-Value=6.1) 27 6.5 SB_59035| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_46125| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_24828| Best HMM Match : Peptidase_A17 (HMM E-Value=1.7e-23) 27 8.6 >SB_40445| Best HMM Match : rve (HMM E-Value=0.0008) Length = 467 Score = 28.7 bits (61), Expect = 2.1 Identities = 21/83 (25%), Positives = 37/83 (44%) Frame = +2 Query: 47 LSSPSSFFNRCHIWFDTPAPFFSRYHTQTQKLGLQTPPG*TSHIQKIQEPFIDKPPKLQN 226 + S + N+ H D+ + +T+T+ +G Q G H ++Q PP+ Q+ Sbjct: 202 MQSVVCYNNKLHKATDSMKLGANAINTETKPVGAQNMAG--GH-PRVQHATDHAPPRRQS 258 Query: 227 TLLLTARHSTHPTVAKERSDFVA 295 T PT++ E+SD A Sbjct: 259 TPAKVHAEGAAPTLSGEKSDHTA 281 >SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) Length = 699 Score = 28.7 bits (61), Expect = 2.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 114 LKNGAGVSNHMWHRLKNDDGDDKPCLNCVIYVA 16 + NG ++NH + G +K C+N V YVA Sbjct: 63 MNNGRRIANHDMQGISFASGGEKDCVNMVGYVA 95 >SB_26245| Best HMM Match : Homeobox (HMM E-Value=1.7e-32) Length = 1168 Score = 27.5 bits (58), Expect = 4.9 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = +2 Query: 125 TQTQKLGLQTPPG*TSHIQKIQEPFIDKPPKLQNTLLLTARHSTHPTVAK 274 T TQ Q+P +H + +P PPK Q+ T+ H+T T + Sbjct: 718 TTTQHFYNQSPLHHQNHNTTLLQPVTITPPKPQHNTSTTSHHNTTKTTTQ 767 >SB_700| Best HMM Match : Fer4 (HMM E-Value=0.04) Length = 202 Score = 27.5 bits (58), Expect = 4.9 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 235 INSQTFHTSDSSEGTKRFRRLPSFGFRLLQNRVCKIL 345 I SQ+ + SD++E T + P FG RL + C I+ Sbjct: 90 IESQSENESDNAEETCKILATPPFGSRLRRCGYCAIM 126 >SB_54763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1190 Score = 27.1 bits (57), Expect = 6.5 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +1 Query: 226 HATINSQTFHTSDSSEGTKRFRRLPSF 306 H T + F T D +G++ F R+P+F Sbjct: 482 HCTQKRRGFQTCDKPQGSQSFPRIPTF 508 >SB_5783| Best HMM Match : PIR (HMM E-Value=6.1) Length = 215 Score = 27.1 bits (57), Expect = 6.5 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 158 PG*TSHIQKIQEPFIDKPPKLQNTLLLTARHSTHPTVAKER 280 PG S + Q+P + PP+ + L L+ RH T + A+ER Sbjct: 44 PGQLSQQSQSQQPQM-MPPQQKRELTLSVRHLTQMSSAEER 83 >SB_59035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 26.6 bits (56), Expect = 8.6 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +3 Query: 261 RQ*RRNEAISSPALVWLSTVTKSC 332 +Q +N+A S P ++WLS V ++C Sbjct: 102 KQAAQNDAQSFPLILWLSVVRQNC 125 >SB_46125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1564 Score = 26.6 bits (56), Expect = 8.6 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = -1 Query: 273 FATVGCVECLAVNSSVFCNFGGLSMNGSWI 184 F + CL S++ C +G +++ G WI Sbjct: 1453 FVSKAASRCLPRGSALHCGYGFITLGGIWI 1482 >SB_24828| Best HMM Match : Peptidase_A17 (HMM E-Value=1.7e-23) Length = 1531 Score = 26.6 bits (56), Expect = 8.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 117 RLKNGAGVSNHMWHRLKNDDGDD 49 +LK+GA ++H WH + GDD Sbjct: 377 KLKDGAKTTDHNWHVHEKPVGDD 399 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,074,386 Number of Sequences: 59808 Number of extensions: 237424 Number of successful extensions: 645 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 620 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 645 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 814166562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -