BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10k22 (738 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 27 0.21 DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 25 0.64 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 23 2.6 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 5.9 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 26.6 bits (56), Expect = 0.21 Identities = 14/61 (22%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +2 Query: 416 LVDDTGTPRPYLCNNGRLNMNL--DTVQFSPDACECSSGYEKMLFRQTALARTIPVCIPN 589 + DDT + YLCN G+L + + + + ++ D C+ E + +A + +P+ Sbjct: 2243 VADDTNCAQYYLCNQGQLQLQVCPNGLFWNKDHCDWPENTECHPDASSTMAPSTTPMVPD 2302 Query: 590 R 592 + Sbjct: 2303 K 2303 Score = 21.4 bits (43), Expect = 7.9 Identities = 6/18 (33%), Positives = 12/18 (66%) Frame = -2 Query: 632 LHFSCKRVYTNWPSDSEC 579 LH++ +R +WP ++C Sbjct: 1135 LHWNKERKICDWPKSAKC 1152 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 25.0 bits (52), Expect = 0.64 Identities = 15/49 (30%), Positives = 18/49 (36%) Frame = +2 Query: 332 DPALGLLHIFSAGGDFVVSQACVSTYRDLVDDTGTPRPYLCNNGRLNMN 478 DP + I G F++S D G P PY N G L N Sbjct: 247 DPQKVTIGIAFYGHHFILSDPSKHGLNDATAAPGEPGPYTVNLGSLGYN 295 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 570 IVRASAVWRNSIFS 529 IVR AVWR+ +F+ Sbjct: 218 IVRLEAVWRSGVFA 231 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/33 (27%), Positives = 11/33 (33%) Frame = -2 Query: 671 FVKARTSSC*QNLLHFSCKRVYTNWPSDSECTR 573 F +C L CKR+Y C R Sbjct: 771 FDSCTVCTCDAKYLEIKCKRIYNEKQCCKNCAR 803 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,949 Number of Sequences: 336 Number of extensions: 4042 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -