BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10k16 (801 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 2.5 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 4.4 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.4 bits (48), Expect = 2.5 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +3 Query: 336 KTMLTRWEEDGLSVLRKNN 392 KT L++W +DG +V +K N Sbjct: 226 KTKLSQWRKDGGTVKKKVN 244 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.6 bits (46), Expect = 4.4 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -3 Query: 229 VECSQLNKILLPCFVSVIVVKPETPLVL*RVLDQK 125 VE + N C S I+V PET L +DQK Sbjct: 1230 VEMPRSNADYEVCIGSQIMVSPETLLSYDEKMDQK 1264 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,805 Number of Sequences: 438 Number of extensions: 4550 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25367793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -