BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10k13 (755 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 3.5 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 23 3.5 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 6.1 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 8.0 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 8.0 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 8.0 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 334 YYVLKSIISDLLMGAQGKVFDPL 402 YYV +S +S L A+ +FDP+ Sbjct: 575 YYVCRSGLSYHLSCAENMMFDPM 597 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +1 Query: 103 LEVVIITNSDGDHDGYLELTAAAKIMSPFISN 198 ++V+ DG H GY++ A A + P +++ Sbjct: 1 MDVLQKNYDDGIHPGYMDGGAGAGLYEPHVAH 32 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/45 (22%), Positives = 21/45 (46%) Frame = +1 Query: 397 PLCEVKTQLCAIQESLNEAISTLNVHAAANSPAPDINKLQDMIQD 531 P C V CA++ +A + + + +PD+ K++ + D Sbjct: 255 PECVVPEVQCAVKRKEKKAQKEKDKPNSTTNGSPDVIKVEPELSD 299 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 343 ERNIL*DVFYYSNCNLTDI 287 ERN+ V Y N N+TD+ Sbjct: 14 ERNLSYKVMYNGNNNVTDL 32 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 496 PDINKLQDMIQDLQSEYNK 552 P +NK +D+ QDL + +K Sbjct: 286 PKLNKHEDLPQDLSMKLSK 304 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 496 PDINKLQDMIQDLQSEYNK 552 P +NK +D+ QDL + +K Sbjct: 178 PKLNKHEDLPQDLSMKLSK 196 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,724 Number of Sequences: 336 Number of extensions: 4233 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -