SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmnc10k13
         (755 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein RJP...    23   2.3  
AF205594-1|AAQ13840.1|  156|Apis mellifera acid phosphatase prec...    21   9.4  

>Z26319-1|CAA81228.1|  464|Apis mellifera royal jelly protein
           RJP57-2 protein.
          Length = 464

 Score = 23.4 bits (48), Expect = 2.3
 Identities = 9/35 (25%), Positives = 18/35 (51%)
 Frame = +1

Query: 28  KNGIMKTDAQSTSNTHNFMYSPDNNLEVVIITNSD 132
           K  ++    Q+  +T+  +Y  DN   ++I  N+D
Sbjct: 184 KGELVSLTVQAMDSTNTMVYMVDNKNTLIIYQNAD 218


>AF205594-1|AAQ13840.1|  156|Apis mellifera acid phosphatase
           precursor protein.
          Length = 156

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = -3

Query: 261 IFIVFNQFVRWRR 223
           IF+ FN  VR+RR
Sbjct: 23  IFLYFNSLVRFRR 35


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 228,375
Number of Sequences: 438
Number of extensions: 4978
Number of successful extensions: 12
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23753925
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -