BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10k10 (727 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1020.08 |||wybutosine biosynthesis protein Tyw1|Schizosaccha... 27 2.1 SPAC18B11.10 |tup11||transcriptional corepressor Tup11|Schizosac... 27 3.6 SPAC2F3.09 |hem1||5-aminolevulinate synthase|Schizosaccharomyces... 25 8.3 SPBC14F5.11c |mug186||sorting nexin Snx41|Schizosaccharomyces po... 25 8.3 >SPCC1020.08 |||wybutosine biosynthesis protein Tyw1|Schizosaccharomyces pombe|chr 3|||Manual Length = 688 Score = 27.5 bits (58), Expect = 2.1 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +3 Query: 291 DGMIKNEDVQRFNRINRNDLI-SACMQINVQTYMPNATIDMRKQPNCIYF 437 D + K +V+RF R+ + I S I Q N TID + P C+++ Sbjct: 50 DEVKKQREVKRFKRVGKRGKIGSPSSSIRKQ----NDTIDWKNSPLCVFY 95 >SPAC18B11.10 |tup11||transcriptional corepressor Tup11|Schizosaccharomyces pombe|chr 1|||Manual Length = 614 Score = 26.6 bits (56), Expect = 3.6 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 580 STNYLKCSASTPEGICSNTTTSCSQFVL 663 +T + SA PEGIC T T + FVL Sbjct: 515 ATRSVGLSAIKPEGICKATYTGHTDFVL 542 >SPAC2F3.09 |hem1||5-aminolevulinate synthase|Schizosaccharomyces pombe|chr 1|||Manual Length = 558 Score = 25.4 bits (53), Expect = 8.3 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 252 PHFDHLTRLRDLIDGMIKNEDVQRFNRINR 341 P FD+ T R+ +D +++ + FN INR Sbjct: 130 PRFDYDTFYREELDKKHRDKSYRYFNNINR 159 >SPBC14F5.11c |mug186||sorting nexin Snx41|Schizosaccharomyces pombe|chr 2|||Manual Length = 586 Score = 25.4 bits (53), Expect = 8.3 Identities = 13/59 (22%), Positives = 28/59 (47%) Frame = +3 Query: 147 IYYWIKLH*MKLTYKMVSLLKYALRLTREYKENIIPHFDHLTRLRDLIDGMIKNEDVQR 323 I Y IKL ++ ++ ++L+R Y ++P ++ D + + KN+ + R Sbjct: 89 IVYIIKLQDSEIHHRYSEFASLRVQLSRLYPTCLVPPLPDKHKIMDYLINVTKNQRMSR 147 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,763,834 Number of Sequences: 5004 Number of extensions: 54550 Number of successful extensions: 143 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 143 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 341222980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -