BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10k09 (391 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 25 0.20 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 22 2.5 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 4.3 AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esteras... 21 5.7 AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 21 5.7 AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esteras... 21 5.7 AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esteras... 21 5.7 AJ850287-1|CAH64507.1| 509|Tribolium castaneum putative esteras... 21 5.7 AF260823-1|AAG02021.1| 138|Tribolium castaneum alpha-esterase l... 21 5.7 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 25.4 bits (53), Expect = 0.20 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -3 Query: 326 RLNRIQKLGFSA*ALGVWRIRSSV 255 RLN I+KL A ALGV R RS + Sbjct: 30 RLNSIKKLSTIALALGVERTRSEL 53 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 21.8 bits (44), Expect = 2.5 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 96 RILDAIAETNTKVDSVQTQLNGLEESFQPLD 188 RI D I K +V ++ G+EE+ P+D Sbjct: 143 RITDPINIRKCKPKTVVPEVGGVEEAKGPVD 173 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.0 bits (42), Expect = 4.3 Identities = 9/37 (24%), Positives = 18/37 (48%) Frame = +3 Query: 21 FVY*LKSYTVNYILFTIMSKPNVLTRILDAIAETNTK 131 F+Y +SYT + F + + +R +D + T + Sbjct: 415 FLYNGRSYTYQVLPFGLKTAVGSFSRAMDVVLGTEVR 451 >AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 20.6 bits (41), Expect = 5.7 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 291 VGFRSLEDPE 262 +GF SLEDP+ Sbjct: 144 IGFLSLEDPD 153 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 20.6 bits (41), Expect = 5.7 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 291 VGFRSLEDPE 262 +GF SLEDP+ Sbjct: 144 IGFLSLEDPD 153 >AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 20.6 bits (41), Expect = 5.7 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 291 VGFRSLEDPE 262 +GF SLEDP+ Sbjct: 144 IGFLSLEDPD 153 >AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esterase protein. Length = 510 Score = 20.6 bits (41), Expect = 5.7 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 291 VGFRSLEDPE 262 +GF SLEDP+ Sbjct: 144 IGFLSLEDPD 153 >AJ850287-1|CAH64507.1| 509|Tribolium castaneum putative esterase protein. Length = 509 Score = 20.6 bits (41), Expect = 5.7 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 291 VGFRSLEDPE 262 +GF SLEDP+ Sbjct: 143 IGFLSLEDPD 152 >AF260823-1|AAG02021.1| 138|Tribolium castaneum alpha-esterase like protein E4 protein. Length = 138 Score = 20.6 bits (41), Expect = 5.7 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -2 Query: 291 VGFRSLEDPE 262 +GF SLEDP+ Sbjct: 116 IGFLSLEDPD 125 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,945 Number of Sequences: 336 Number of extensions: 1183 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8225022 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -