BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10k09 (391 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 27 0.24 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 26 0.42 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 27.1 bits (57), Expect = 0.24 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 249 SIWIEFLRF*C*NRSIERANRPKAGTILPA 160 SIW E L+F C + + R +RP ++ A Sbjct: 776 SIWAESLKFECRKQWLRRCHRPLVNRVISA 805 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 26.2 bits (55), Expect = 0.42 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +3 Query: 120 TNTKVDSVQTQLNGLEESFQPLDGLPAQLT 209 TN+KV +QT++NGL + L ++LT Sbjct: 891 TNSKVKVLQTKINGLGKQIDKLSANISKLT 920 Score = 21.8 bits (44), Expect = 9.1 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +3 Query: 111 IAETNTKVDSVQTQLNGLEESFQPLDGLPAQLT 209 I + + +QTQ+N L+E L+ +LT Sbjct: 772 IEQMQIRAQEIQTQINYLQEQQGELEATIQRLT 804 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 309,800 Number of Sequences: 2352 Number of extensions: 4774 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 30356973 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -