BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10k08 (733 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U23484-8|AAC46765.1| 1200|Caenorhabditis elegans Masculinisation... 28 5.9 AF286899-1|AAG01332.1| 1200|Caenorhabditis elegans sex determini... 28 5.9 Z99288-9|CAB16551.2| 335|Caenorhabditis elegans Hypothetical pr... 28 7.8 >U23484-8|AAC46765.1| 1200|Caenorhabditis elegans Masculinisation of germline protein5 protein. Length = 1200 Score = 28.3 bits (60), Expect = 5.9 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 3/63 (4%) Frame = +2 Query: 509 KYKSVDDAQRRHKQNCKFVNAIEDYSVNEHFSKLDVAEKEIL---AADLSPPQLSVKPSA 679 + ++V D +R + VN IE+ ++ ++D E L DL+P + V+P Sbjct: 273 RVQTVADVLKRGENVKVKVNKIENGKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRT 332 Query: 680 PPA 688 PPA Sbjct: 333 PPA 335 >AF286899-1|AAG01332.1| 1200|Caenorhabditis elegans sex determining protein MOG-5 protein. Length = 1200 Score = 28.3 bits (60), Expect = 5.9 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 3/63 (4%) Frame = +2 Query: 509 KYKSVDDAQRRHKQNCKFVNAIEDYSVNEHFSKLDVAEKEIL---AADLSPPQLSVKPSA 679 + ++V D +R + VN IE+ ++ ++D E L DL+P + V+P Sbjct: 273 RVQTVADVLKRGENVKVKVNKIENGKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRT 332 Query: 680 PPA 688 PPA Sbjct: 333 PPA 335 >Z99288-9|CAB16551.2| 335|Caenorhabditis elegans Hypothetical protein ZK262.10 protein. Length = 335 Score = 27.9 bits (59), Expect = 7.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 260 SLYI*SGYCEKTAPFWPIQIC 198 S Y+ GY EKT+P+ P +C Sbjct: 73 SYYVVDGYFEKTSPYAPFVLC 93 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,675,493 Number of Sequences: 27780 Number of extensions: 348246 Number of successful extensions: 913 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 886 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 913 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1714401074 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -