BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10k07 (723 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1556.02c |sdh1||succinate dehydrogenase Sdh1|Schizosaccharom... 27 3.6 SPBC365.02c |cox10||protoheme IX farnesyltransferase|Schizosacch... 27 3.6 SPBC2A9.09 |||phosducin family protein|Schizosaccharomyces pombe... 27 3.6 SPBC24C6.10c |||conserved eukaryotic protein|Schizosaccharomyces... 26 6.3 SPCP25A2.02c |rhp26||SNF2 family helicase Rhp26|Schizosaccharomy... 26 6.3 SPBC18H10.21c ||SPBC9B6.01c|dubious|Schizosaccharomyces pombe|ch... 26 6.3 SPBC1683.09c |frp1||ferric-chelate reductase Frp1|Schizosaccharo... 26 6.3 >SPAC1556.02c |sdh1||succinate dehydrogenase Sdh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 641 Score = 26.6 bits (56), Expect = 3.6 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +3 Query: 72 YRQSSPPVRLTGDVYVVDKNEKVFLVKHVFSNTVPAYLLIRG 197 Y P R TG+V +D+N K +V +++ A + + G Sbjct: 401 YNMGGIPTRFTGEVLTIDENGKDKIVPGLYAAGEAACVSVHG 442 >SPBC365.02c |cox10||protoheme IX farnesyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 387 Score = 26.6 bits (56), Expect = 3.6 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -1 Query: 198 HLLLKDMQAPCLRTRV*LKKLFRSYQQHTRRPS 100 H+L K C+ TR LK+ + + +HT + S Sbjct: 3 HILNKGSSKSCIYTRPCLKRFYHQHYEHTGKLS 35 >SPBC2A9.09 |||phosducin family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 233 Score = 26.6 bits (56), Expect = 3.6 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = +3 Query: 117 VVDKNEKVFLVKHVFSNTVPAYLLI 191 V D +++VF+V H+F +++PA L+ Sbjct: 101 VTDASKEVFVVVHMFQDSLPACKLL 125 >SPBC24C6.10c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 374 Score = 25.8 bits (54), Expect = 6.3 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -2 Query: 683 LFIAVYNFGDRSNFVAFDTFHF-YTLIYNIC 594 L A+ F DRS VAF +F + L+Y IC Sbjct: 125 LIKAMKQFKDRSENVAFTSFRYALFLVYYIC 155 >SPCP25A2.02c |rhp26||SNF2 family helicase Rhp26|Schizosaccharomyces pombe|chr 3|||Manual Length = 973 Score = 25.8 bits (54), Expect = 6.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 630 VKCNKVRTVTEIVNSDEKIQKNL 698 + C ++RTV I+ S IQ NL Sbjct: 455 ISCKQIRTVNRIILSGTPIQNNL 477 >SPBC18H10.21c ||SPBC9B6.01c|dubious|Schizosaccharomyces pombe|chr 2|||Manual Length = 157 Score = 25.8 bits (54), Expect = 6.3 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 375 NSKHVFDHFGCSSNYCFNNYV 437 N VF+H CS Y FNN V Sbjct: 2 NGLRVFEHVHCSVLYKFNNIV 22 >SPBC1683.09c |frp1||ferric-chelate reductase Frp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 564 Score = 25.8 bits (54), Expect = 6.3 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 624 KRVKCNKVRTVTEIVNSDEKIQKNLRIG 707 K+V + V++I SDEKI+KN +G Sbjct: 346 KKVSSKSLSDVSDINISDEKIEKNGDVG 373 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,657,184 Number of Sequences: 5004 Number of extensions: 49801 Number of successful extensions: 142 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 142 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 339215786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -