BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10k02 (606 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homoc... 25 1.9 AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin bi... 23 5.8 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 23 5.8 AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 23 5.8 AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 23 5.8 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 5.8 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 23 7.7 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 7.7 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 23 7.7 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 23 7.7 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 23 7.7 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 23 7.7 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 23 7.7 >AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homocysteine hydrolase protein. Length = 432 Score = 25.0 bits (52), Expect = 1.9 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +1 Query: 274 LRYESRSGVHNMYREYRDLSVG 339 L E+ +GVHN+Y+ +R+ +G Sbjct: 153 LSEETTTGVHNLYKMFREGRLG 174 >AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin binding protein protein. Length = 567 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -1 Query: 99 GLVLRRELAADNLIFSQLSFSLHFWSFYLKKKS 1 GL+++ L ++ +F Q ++W FY+ KS Sbjct: 411 GLIMKSFLCPESTLFDQTVLKCNWW-FYVDCKS 442 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -1 Query: 99 GLVLRRELAADNLIFSQLSFSLHFWSFYLKKKS 1 GL+++ L ++ +F Q ++W FY+ KS Sbjct: 419 GLIMKSFLCPESTLFDQTVLKCNWW-FYVDCKS 450 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 23.4 bits (48), Expect = 5.8 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +2 Query: 461 SSTTAPSDSHCPNVCTTTRDLIPSRTRGLALTSCNCN 571 ++T + + +C C + +PSR R LT C+ N Sbjct: 56 AATCSDATHYC---CPDRSEQLPSRNRPKLLTQCDSN 89 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 23.4 bits (48), Expect = 5.8 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 97 PKPPLYKMRIFSPDPIVAKSRFWY 168 P+P Y+ FSPD + + + Y Sbjct: 414 PEPEQYRPERFSPDEVARRDPYCY 437 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.4 bits (48), Expect = 5.8 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -1 Query: 261 VLNLDGAFLWNFLNRDNFTSGLLELLKLSQEIPETRFGD 145 +L L +FL+N R F + E+LK +++ +GD Sbjct: 1133 ILVLSKSFLYNEWTRFEFKGAIHEVLKRRRKLIIILYGD 1171 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +3 Query: 441 SPSTGQTVPQQHHQIPIAQTCAPL 512 +P + P HH PIA AP+ Sbjct: 182 APIAHYSAPIAHHAAPIAHYAAPI 205 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +3 Query: 441 SPSTGQTVPQQHHQIPIAQTCAPL 512 +P + P HH PIA AP+ Sbjct: 178 APIAHYSAPIAHHAAPIAHYAAPI 201 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +3 Query: 441 SPSTGQTVPQQHHQIPIAQTCAPL 512 +P + P HH PIA AP+ Sbjct: 190 APIAHYSAPIAHHAAPIAHYAAPI 213 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +3 Query: 441 SPSTGQTVPQQHHQIPIAQTCAPL 512 +P + P HH PIA AP+ Sbjct: 190 APIAHYSAPIAHHAAPIAHYAAPI 213 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +3 Query: 441 SPSTGQTVPQQHHQIPIAQTCAPL 512 +P + P HH PIA AP+ Sbjct: 214 APIAHYSAPIAHHAAPIAHYAAPI 237 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +3 Query: 441 SPSTGQTVPQQHHQIPIAQTCAPL 512 +P + P HH PIA AP+ Sbjct: 182 APIAHYSAPIAHHAAPIAHYAAPI 205 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +3 Query: 441 SPSTGQTVPQQHHQIPIAQTCAPL 512 +P + P HH PIA AP+ Sbjct: 190 APIAHYSAPIAHHAAPIAHYAAPI 213 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 645,862 Number of Sequences: 2352 Number of extensions: 14562 Number of successful extensions: 121 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 121 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58870980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -