BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10j23 (448 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12441| Best HMM Match : Ribosomal_L18p (HMM E-Value=0) 66 9e-12 SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 34 0.047 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 33 0.14 SB_57099| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_39125| Best HMM Match : DUF164 (HMM E-Value=0.082) 33 0.14 SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.19 SB_31593| Best HMM Match : Ribonuclease_3 (HMM E-Value=6.30024e-42) 31 0.33 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 31 0.33 SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_45585| Best HMM Match : Swi3 (HMM E-Value=0.37) 30 0.76 SB_39358| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.76 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) 30 1.0 SB_2860| Best HMM Match : IncA (HMM E-Value=0.41) 30 1.0 SB_46988| Best HMM Match : HEAT (HMM E-Value=8.6e-06) 29 1.3 SB_32582| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) 29 1.3 SB_28851| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_11458| Best HMM Match : GTP_CDC (HMM E-Value=2.6e-09) 29 1.8 SB_37866| Best HMM Match : CDC37 (HMM E-Value=0.81) 29 2.3 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 29 2.3 SB_58675| Best HMM Match : RVT_1 (HMM E-Value=0) 28 3.1 SB_53951| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_53103| Best HMM Match : DUF1388 (HMM E-Value=0.29) 28 3.1 SB_44297| Best HMM Match : RVT_1 (HMM E-Value=0) 28 3.1 SB_43459| Best HMM Match : VWA (HMM E-Value=1.8e-23) 28 3.1 SB_36211| Best HMM Match : RVT_1 (HMM E-Value=0) 28 3.1 SB_24771| Best HMM Match : RVT_1 (HMM E-Value=0) 28 3.1 SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_12151| Best HMM Match : AAA_5 (HMM E-Value=0.00042) 28 3.1 SB_1761| Best HMM Match : ERF (HMM E-Value=6.8) 28 3.1 SB_47629| Best HMM Match : Vicilin_N (HMM E-Value=1.1) 28 3.1 SB_42440| Best HMM Match : RnaseH (HMM E-Value=0.9) 28 3.1 SB_30749| Best HMM Match : FARP (HMM E-Value=0.032) 28 3.1 SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_13410| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_23651| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_26400| Best HMM Match : RVT_1 (HMM E-Value=1.1e-30) 28 4.0 SB_21831| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048) 28 4.0 SB_29552| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_51415| Best HMM Match : zf-CCCH (HMM E-Value=1.1) 27 5.3 SB_50343| Best HMM Match : MAP (HMM E-Value=3.4) 27 5.3 SB_35419| Best HMM Match : SMC_C (HMM E-Value=1.9e-05) 27 7.1 SB_35415| Best HMM Match : BRF1 (HMM E-Value=4.4) 27 7.1 SB_26062| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_13895| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_7120| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_56872| Best HMM Match : RVT_1 (HMM E-Value=2.7e-30) 27 9.3 SB_53654| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_51640| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_46263| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 27 9.3 SB_34899| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00019) 27 9.3 SB_34436| Best HMM Match : SAM_1 (HMM E-Value=5.1) 27 9.3 SB_32921| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_30986| Best HMM Match : 7tm_1 (HMM E-Value=0) 27 9.3 SB_19150| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_17803| Best HMM Match : SRCR (HMM E-Value=0) 27 9.3 SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_16177| Best HMM Match : SAM_1 (HMM E-Value=5.1) 27 9.3 SB_15224| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) 27 9.3 SB_2863| Best HMM Match : Asp (HMM E-Value=1.2e-07) 27 9.3 SB_1096| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_1034| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 27 9.3 SB_913| Best HMM Match : E-MAP-115 (HMM E-Value=1.7) 27 9.3 SB_59736| Best HMM Match : RVT_1 (HMM E-Value=8.2e-31) 27 9.3 SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) 27 9.3 SB_43536| Best HMM Match : DUF1410 (HMM E-Value=3.5) 27 9.3 SB_43054| Best HMM Match : SAM_1 (HMM E-Value=5.2) 27 9.3 SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) 27 9.3 SB_40130| Best HMM Match : SAM_1 (HMM E-Value=5.1) 27 9.3 SB_18267| Best HMM Match : SAM_1 (HMM E-Value=5.1) 27 9.3 SB_9039| Best HMM Match : M (HMM E-Value=0.00046) 27 9.3 SB_867| Best HMM Match : Leo1 (HMM E-Value=0) 27 9.3 >SB_12441| Best HMM Match : Ribosomal_L18p (HMM E-Value=0) Length = 328 Score = 66.5 bits (155), Expect = 9e-12 Identities = 32/56 (57%), Positives = 46/56 (82%) Frame = +3 Query: 216 IEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIK 383 IE IYK AH+AIRADP HKK E KKD V+ KR++++K++ +R +R+KQKKA+F++ Sbjct: 268 IEGIYKAAHQAIRADPVHKKAE-KKD-VQLKRFHRKKMSRQQRVDRVKQKKAAFLR 321 Score = 35.5 bits (78), Expect = 0.020 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +3 Query: 162 RRREGKTDYYARKRLVVQ 215 RR +GKTDYYARKRL+ Q Sbjct: 17 RRSQGKTDYYARKRLITQ 34 >SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 35.5 bits (78), Expect = 0.020 Identities = 20/71 (28%), Positives = 39/71 (54%) Frame = +3 Query: 192 ARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKA 371 A++ +V +A + ++A P+ KKK+ KK K+K+ K+K ++K + K+KK Sbjct: 125 AKEEMVAATKAA-EALYQAFPQPPTKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK 183 Query: 372 SFIKRLQAQAE 404 K+ + + E Sbjct: 184 KKKKKKKEEEE 194 Score = 29.5 bits (63), Expect = 1.3 Identities = 19/62 (30%), Positives = 31/62 (50%) Frame = +3 Query: 219 EAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQAQ 398 EA+Y+ A KKK+ KK K+K+ K+K ++K + K+KK K + + Sbjct: 137 EALYQ-AFPQPPTKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKEEEEE 195 Query: 399 AE 404 E Sbjct: 196 EE 197 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 34.3 bits (75), Expect = 0.047 Identities = 26/87 (29%), Positives = 46/87 (52%), Gaps = 1/87 (1%) Frame = +3 Query: 108 VKVVKNKQYF-KRYQVKFKRRREGKTDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKEL 284 +K +K+K+ K + K KR RE K RKR Q+E K+ + + + ++KE Sbjct: 898 LKEMKDKEKIEKEKREKDKREREEKE----RKRRQQQLEKEKKEKEKKLLIEKEKREKEK 953 Query: 285 KKDSVKQKRWNKRKLTLAERKNRIKQK 365 +K+ +++K K K AER + K++ Sbjct: 954 QKERLREKE-EKEKQKEAERAKKEKER 979 >SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) Length = 1312 Score = 32.7 bits (71), Expect = 0.14 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +3 Query: 147 QVKFKRRREGKTDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKDSVKQKR-WNKR 323 Q K + + +R+RLV+QIE + E + K +ELK++ K KR N Sbjct: 896 QAKLSYKEGSEISKMSRERLVLQIEQDFLGKLEKAKVPLEDKIRELKEELSKAKREQNTA 955 Query: 324 KLTLAERKNRIKQK 365 K L + K ++Q+ Sbjct: 956 KSALEQEKADLQQE 969 >SB_57099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2509 Score = 32.7 bits (71), Expect = 0.14 Identities = 19/64 (29%), Positives = 36/64 (56%) Frame = +2 Query: 257 GSIPQEERVKERLGQTEALEQTQANIGREEKQNQAKEGFLHQETAGSGGSLNALNIIFEA 436 G+I + VK+ LG+ E + T A + + +Q + + +++ G +++ALN +F Sbjct: 1931 GAIRALQEVKKHLGKLEPVSSTLAELRTQAQQFKVYQNEINKH----GTTVDALNEMFHG 1986 Query: 437 LKKK 448 LKKK Sbjct: 1987 LKKK 1990 >SB_39125| Best HMM Match : DUF164 (HMM E-Value=0.082) Length = 363 Score = 32.7 bits (71), Expect = 0.14 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +3 Query: 147 QVKFKRRREGKTDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKDSVKQKR-WNKR 323 Q K + + +R+RLV+QIE + E + K +ELK++ K KR N Sbjct: 176 QAKLSYKEGSEISKMSRERLVLQIEQDFLGKLEKAKVPLEDKIRELKEELSKAKREQNTA 235 Query: 324 KLTLAERKNRIKQK 365 K L + K ++Q+ Sbjct: 236 KSALEQEKADLQQE 249 >SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2735 Score = 32.3 bits (70), Expect = 0.19 Identities = 22/66 (33%), Positives = 35/66 (53%) Frame = +3 Query: 159 KRRREGKTDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLA 338 KR+RE + RKR + K+ E+++ HK+K+ K+ S K KR +KRK Sbjct: 198 KRKRELAKHKHKRKRKRESAKHRLKRKRESVK----HKRKQ-KRKSAKHKRKHKRKSDKH 252 Query: 339 ERKNRI 356 +RK + Sbjct: 253 KRKQTL 258 Score = 30.7 bits (66), Expect = 0.57 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +3 Query: 222 AIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKK 368 A +K + R H+ K K++SVK KR KRK +RK++ K K Sbjct: 204 AKHKHKRKRKRESAKHRLKR-KRESVKHKRKQKRKSAKHKRKHKRKSDK 251 Score = 27.9 bits (59), Expect = 4.0 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +3 Query: 117 VKNKQYFKRYQVKFKRRREGKTDYYARKRLVV 212 VK+K+ KR K KR+ + K+D + RK+ ++ Sbjct: 228 VKHKRKQKRKSAKHKRKHKRKSDKHKRKQTLI 259 >SB_31593| Best HMM Match : Ribonuclease_3 (HMM E-Value=6.30024e-42) Length = 618 Score = 31.5 bits (68), Expect = 0.33 Identities = 15/64 (23%), Positives = 28/64 (43%) Frame = +3 Query: 162 RRREGKTDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAE 341 R + K Y + R+++Q+ + H +P H + L VKQ R+ R++ Sbjct: 46 RTLDAKLGYTFKDRMLLQLALSHPSYHLNYGMNPDHARNSLSNCGVKQPRYGDRRIHNVH 105 Query: 342 RKNR 353 K + Sbjct: 106 SKKK 109 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 31.5 bits (68), Expect = 0.33 Identities = 28/103 (27%), Positives = 49/103 (47%), Gaps = 4/103 (3%) Frame = +3 Query: 111 KVVKNKQYFKRYQVKFKRRREGKTDYYARKRLVVQIEAIYKKAHEAI----RADPSHKKK 278 K K KQ + K K R E K ++RL Q E KK E + R + +K Sbjct: 325 KEEKEKQRLEAKAAKEKERLEAKQKK-EQERLEKQAEK-EKKEKERLEKKQREEKDRLEK 382 Query: 279 ELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQAQAEA 407 + KK+ K+K+ + + E+K R ++KK ++++ + +A Sbjct: 383 KEKKEEEKRKKEEEINAKIEEKKKREEKKKQEEEEKMKKKEQA 425 >SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.7 bits (66), Expect = 0.57 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +3 Query: 252 RADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKR 386 R + KKK+ KK K+K+ K+K +KN+ K KK +K+ Sbjct: 14 REEKKRKKKKQKKKKKKKKK-KKKKKNKKNKKNKNKNKKKKKMKK 57 Score = 29.5 bits (63), Expect = 1.3 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +3 Query: 228 YKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKK 368 Y++ + + KKK+ KK K+ + NK+ ++K ++K+KK Sbjct: 13 YREEKKRKKKKQKKKKKKKKKKKKKKNKKNKKNKNKNKKKKKMKKKK 59 Score = 27.9 bits (59), Expect = 4.0 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = +3 Query: 249 IRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQAQAE 404 +R + +KK KK K+K+ K+K +KN+ + K K+++ + E Sbjct: 9 MRREYREEKKRKKKKQKKKKKKKKKKKKKKNKKNKKNKNKNKKKKKMKKKKE 60 >SB_45585| Best HMM Match : Swi3 (HMM E-Value=0.37) Length = 341 Score = 30.3 bits (65), Expect = 0.76 Identities = 21/82 (25%), Positives = 42/82 (51%) Frame = +3 Query: 126 KQYFKRYQVKFKRRREGKTDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKDSVKQ 305 +Q K+ +++ KRR+E K ++ +++L E K+ E I K KE+ K Sbjct: 132 EQREKQMRIREKRRKE-KEEFEKQRKLK---EDKQKEIEEKINEWIDKKNKEILKSKTSS 187 Query: 306 KRWNKRKLTLAERKNRIKQKKA 371 ++ ++K E +NR ++K+ Sbjct: 188 QKLQEQKQAEKEEQNRTIEEKS 209 >SB_39358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 30.3 bits (65), Expect = 0.76 Identities = 23/83 (27%), Positives = 37/83 (44%) Frame = +3 Query: 105 FVKVVKNKQYFKRYQVKFKRRREGKTDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKEL 284 F+KV+ N+Q R + KR + K R+ + + Y + E + + + K KEL Sbjct: 56 FLKVM-NQQERSRKSAEAKRESKKKIKETERELVQKGKKPFYLRKSELKKLELAEKYKEL 114 Query: 285 KKDSVKQKRWNKRKLTLAERKNR 353 K QK KR+ A + R Sbjct: 115 KSKGKLQKYLTKRRKKTASKDRR 137 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 29.9 bits (64), Expect = 1.0 Identities = 28/90 (31%), Positives = 48/90 (53%), Gaps = 6/90 (6%) Frame = +3 Query: 117 VKNKQYFKRYQVKFKRRREGKTDYYARKRLVVQIEAIYKKAHEAI--RADPSHKKKELKK 290 ++ KQ R Q + ++R + + +R +IEA+ K+A I R + K +E +K Sbjct: 1180 IRQKQAAWRQQEEEEQRVKERLQILREER--ERIEALNKEADLLIQRRKEAERKAEEKRK 1237 Query: 291 DSVKQKRWNK---RKLT-LAERKNRIKQKK 368 +QKR ++ R+L +AE KNR +Q K Sbjct: 1238 QIERQKRIDEEVERRLQKIAEEKNREEQLK 1267 >SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) Length = 2478 Score = 29.9 bits (64), Expect = 1.0 Identities = 19/64 (29%), Positives = 34/64 (53%) Frame = +3 Query: 213 QIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQ 392 Q+EA K+ HE + +PS + D ++++ K K L + + ++K +A IK L+ Sbjct: 889 QLEAAEKRVHELLSKEPS---SDQDIDKMRKETEEKFKTDLQDTELKLKDAEAK-IKDLE 944 Query: 393 AQAE 404 Q E Sbjct: 945 TQLE 948 >SB_2860| Best HMM Match : IncA (HMM E-Value=0.41) Length = 417 Score = 29.9 bits (64), Expect = 1.0 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 1/89 (1%) Frame = +3 Query: 144 YQVKFKRRREGKTDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKDSVK-QKRWNK 320 +QV+ +R + + ++RLV Q+ A K+ + +HK++EL K VK Q + Sbjct: 182 HQVEMERSKVRDLEQQ-KQRLVEQLYAAEKRYQDKENEFMTHKERELSKPEVKLQSELDF 240 Query: 321 RKLTLAERKNRIKQKKASFIKRLQAQAEA 407 ++ AE + +++ S I Q A Sbjct: 241 LRVEKAELERKLESSNKSKIHYKQQWGRA 269 >SB_46988| Best HMM Match : HEAT (HMM E-Value=8.6e-06) Length = 1231 Score = 29.5 bits (63), Expect = 1.3 Identities = 21/99 (21%), Positives = 49/99 (49%), Gaps = 2/99 (2%) Frame = +3 Query: 117 VKNKQYFKRYQV-KFKRRREGKTDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKD 293 +K++ ++ V K K T + ++++ +YKK IR + KKE ++ Sbjct: 1098 IKSEVLIRKLDVYKRKLGAYSPTRRLQKSEVLIRELDVYKKGEVLIRELDGYNKKERARE 1157 Query: 294 SVKQKRWN-KRKLTLAERKNRIKQKKASFIKRLQAQAEA 407 ++QK+ +R+ AE + ++K+ ++L+ + +A Sbjct: 1158 KMRQKQLRLQREREEAEHQEAERKKEEEAKQKLKQKEDA 1196 Score = 29.5 bits (63), Expect = 1.3 Identities = 18/83 (21%), Positives = 39/83 (46%) Frame = +3 Query: 114 VVKNKQYFKRYQVKFKRRREGKTDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKD 293 +++ +K+ +V + AR+++ + + ++ EA + KK+E K Sbjct: 1129 LIRELDVYKKGEVLIRELDGYNKKERAREKMRQKQLRLQREREEAEHQEAERKKEEEAKQ 1188 Query: 294 SVKQKRWNKRKLTLAERKNRIKQ 362 +KQK ++KL ER+ +Q Sbjct: 1189 KLKQKEDARKKLEEVERRKSQQQ 1211 >SB_32582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1151 Score = 29.5 bits (63), Expect = 1.3 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Frame = +3 Query: 150 VKFKRRREGKTDYYARKRLVVQIEAIY--KKAHEAIRADPSHKKKELKKDSVKQKRWNKR 323 ++ KRR G D++ QI A+Y K +E + +K++++ K K W ++ Sbjct: 630 LEMKRRLVGSDDHWEMPTYYNQIAAVYERKATNEEKKNFFRRSRKKIEEYFTKAKEWYEK 689 Query: 324 KLTLAE 341 + L E Sbjct: 690 AIALQE 695 >SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) Length = 1217 Score = 29.5 bits (63), Expect = 1.3 Identities = 21/85 (24%), Positives = 41/85 (48%) Frame = +3 Query: 138 KRYQVKFKRRREGKTDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWN 317 + Q K K + E K DY+AR + +I + K+ E + AD + + ++ K + Sbjct: 629 RELQTKLKTQ-EKKVDYFARAMRMEEIPLLNKQYEEHLVADREFWENQEEERVRKAIEEH 687 Query: 318 KRKLTLAERKNRIKQKKASFIKRLQ 392 ++ + + R R+ K +FI L+ Sbjct: 688 EKLVETSARLQRMIPDKDAFINTLR 712 >SB_28851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 29.5 bits (63), Expect = 1.3 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +3 Query: 258 DPSHKKKELKKDSVKQKRWNKRK-LTLAERKNRIKQKKA 371 + S KKELK D+ K+ NKRK + +E K KKA Sbjct: 129 ETSESKKELKSDTKSVKKANKRKTMNESESTKTKKPKKA 167 >SB_11458| Best HMM Match : GTP_CDC (HMM E-Value=2.6e-09) Length = 337 Score = 29.1 bits (62), Expect = 1.8 Identities = 23/89 (25%), Positives = 41/89 (46%) Frame = +3 Query: 138 KRYQVKFKRRREGKTDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWN 317 K Y +F+ + E + +K V E KKA + + A H LKK ++K+ Sbjct: 240 KEYMSQFQDKEEKMRQRFVQK--VKDKENELKKAEQELHAKFDH----LKKVQAEEKKKL 293 Query: 318 KRKLTLAERKNRIKQKKASFIKRLQAQAE 404 + K + E + + +K+ + QAQA+ Sbjct: 294 EEKRKMLEEEMSLFEKQKAAANTAQAQAQ 322 >SB_37866| Best HMM Match : CDC37 (HMM E-Value=0.81) Length = 461 Score = 28.7 bits (61), Expect = 2.3 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +3 Query: 234 KAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIK 383 +AH+ A P +KKK KK+ +QK K K+ + K++ K K +K Sbjct: 293 RAHKLTPAKPVNKKKNDKKEQTQQKE-KKNKIN-NDVKSKSKSKIVKILK 340 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 28.7 bits (61), Expect = 2.3 Identities = 16/39 (41%), Positives = 25/39 (64%) Frame = +3 Query: 255 ADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKA 371 A+ H+ +E+KK ++R KR+ LAE+K R +QK A Sbjct: 595 AEAKHQNEEIKKKKEAEER--KRR-ALAEQKERDRQKSA 630 >SB_58675| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 2353 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -1 Query: 169 RRLLNFTWYLLKYCLFFTTLTNPIF*I*VTKWRPQTDTKQKERN 38 RRL+ Y +Y F TL PI+ + +T+ + T TK K R+ Sbjct: 1200 RRLMGLLSYFRRYVHNFATLAAPIYDL-LTEPKGGTSTKSKSRS 1242 >SB_53951| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +3 Query: 270 KKKELKKDSVKQKRWNKRKLTLAERKNRIKQKK 368 KKK+ KK K+K+ NK+K+ E K ++++ Sbjct: 115 KKKKKKKKKKKKKKINKKKINKVEEKEEGEEEE 147 >SB_53103| Best HMM Match : DUF1388 (HMM E-Value=0.29) Length = 462 Score = 28.3 bits (60), Expect = 3.1 Identities = 29/96 (30%), Positives = 40/96 (41%), Gaps = 12/96 (12%) Frame = +3 Query: 120 KNKQYFKRYQVKFKRRREGKTDYYARKRLVVQIEAIYK---KAHEAIRADPSHKKKELKK 290 KN+ + KR ++K RRR+ + K Q A K + H+ + KK KK Sbjct: 352 KNRNHQKRARIKNTRRRQEQKTPEEGKNRKHQKRARTKNTRRRHQQKPPEEGKNKKHQKK 411 Query: 291 DSVKQKR---------WNKRKLTLAERKNRIKQKKA 371 + K R K K T E KN+ QKKA Sbjct: 412 ATTKNTRRGQEQKPPEEGKNKKTPEEGKNKKHQKKA 447 Score = 27.9 bits (59), Expect = 4.0 Identities = 22/84 (26%), Positives = 36/84 (42%) Frame = +3 Query: 120 KNKQYFKRYQVKFKRRREGKTDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKDSV 299 KN+ + K+ + + RRR+G+ K +K E + +K KK Sbjct: 119 KNRNHQKKARTENTRRRQGEKPPEEGKNRNT------RKRQEQKTPEEGKNRKHQKKART 172 Query: 300 KQKRWNKRKLTLAERKNRIKQKKA 371 K R + + T E KN+ QK+A Sbjct: 173 KTTRSRQEQKTPEEGKNKNHQKRA 196 Score = 27.5 bits (58), Expect = 5.3 Identities = 27/89 (30%), Positives = 39/89 (43%), Gaps = 5/89 (5%) Frame = +3 Query: 120 KNKQYFKRYQVKFKRRREGKTDYYARKRLVVQIEAIYKKAHEAIRAD---PSHKK--KEL 284 KNK + K+ Q K EGK + ++ + E KK + R + P K K Sbjct: 249 KNKNHQKQEQ---KTPEEGKNKNHQKRARIETPEEGKKKKNTRRRLEQKTPEEGKNRKPQ 305 Query: 285 KKDSVKQKRWNKRKLTLAERKNRIKQKKA 371 KK K R + + T E KN+ QK+A Sbjct: 306 KKARTKNTRKRQEQKTPKEGKNKNHQKRA 334 >SB_44297| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 824 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -1 Query: 169 RRLLNFTWYLLKYCLFFTTLTNPIF*I*VTKWRPQTDTKQKERN 38 RRL+ Y +Y F TL PI+ + +T+ + T TK K R+ Sbjct: 663 RRLMGLLSYFRRYVHNFATLAAPIYDL-LTEPKGGTSTKSKSRS 705 >SB_43459| Best HMM Match : VWA (HMM E-Value=1.8e-23) Length = 232 Score = 28.3 bits (60), Expect = 3.1 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -3 Query: 185 ISFPFTTPLEFYLVPLEVLFVLHNFNESHILNLSYK 78 ISFPFTT E Y +V F+ N LNL+ + Sbjct: 119 ISFPFTTRKEAYRQLSKVPFIAGTTNTQEALNLAQR 154 >SB_36211| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1020 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -1 Query: 169 RRLLNFTWYLLKYCLFFTTLTNPIF*I*VTKWRPQTDTKQKERN 38 RRL+ Y +Y F TL PI+ + +T+ + T TK K R+ Sbjct: 263 RRLMGLLSYFRRYVHNFATLAAPIYDL-LTEPKGGTSTKSKSRS 305 >SB_24771| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1387 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -1 Query: 169 RRLLNFTWYLLKYCLFFTTLTNPIF*I*VTKWRPQTDTKQKERN 38 RRL+ Y +Y F TL PI+ + +T+ + T TK K R+ Sbjct: 356 RRLMGLLSYFRRYVHNFATLAAPIYDL-LTEPKGGTSTKSKSRS 398 >SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 737 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 267 HKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKK 368 HK K+ K++ K++R + K +ERK ++KK Sbjct: 191 HKDKKKKREESKERRRHSDKAEKSERKREKEEKK 224 >SB_12151| Best HMM Match : AAA_5 (HMM E-Value=0.00042) Length = 4607 Score = 28.3 bits (60), Expect = 3.1 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 285 KKDSVKQKRWNKRKLTLAERKNRIKQK 365 +KD + RW+KR +L + K R+K+K Sbjct: 709 EKDLSLRSRWSKRVHSLIDEKTRVKEK 735 >SB_1761| Best HMM Match : ERF (HMM E-Value=6.8) Length = 299 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -1 Query: 169 RRLLNFTWYLLKYCLFFTTLTNPIF*I*VTKWRPQTDTKQKERN 38 RRL+ Y +Y F TL PI+ + +T+ + T TK K R+ Sbjct: 97 RRLMGLLSYFRRYVHNFATLAAPIYDL-LTEPKGGTSTKSKNRS 139 >SB_47629| Best HMM Match : Vicilin_N (HMM E-Value=1.1) Length = 599 Score = 28.3 bits (60), Expect = 3.1 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = +3 Query: 243 EAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQ 392 E R +KKE KK+ K+++ ++K ERK K+++ K+ + Sbjct: 35 EQEREKKERRKKERKKERKKERKKERKKEKKKERKKERKEERKKERKKAE 84 Score = 28.3 bits (60), Expect = 3.1 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +3 Query: 270 KKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQAQAEA 407 +KKE KK+ K+++ K+K ERK K+++ K+ E+ Sbjct: 48 RKKERKKERKKERKKEKKKERKKERKEERKKERKKAEKKFTDSNES 93 Score = 26.6 bits (56), Expect = 9.3 Identities = 18/68 (26%), Positives = 33/68 (48%) Frame = +3 Query: 159 KRRREGKTDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLA 338 K R+ GK D ++R E ++ E + +KKE KK+ K+++ +++ Sbjct: 24 KTRKGGKRDEREQER-----EKKERRKKERKKERKKERKKERKKEKKKERKKERKEERKK 78 Query: 339 ERKNRIKQ 362 ERK K+ Sbjct: 79 ERKKAEKK 86 >SB_42440| Best HMM Match : RnaseH (HMM E-Value=0.9) Length = 348 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -1 Query: 169 RRLLNFTWYLLKYCLFFTTLTNPIF*I*VTKWRPQTDTKQKERN 38 RRL+ Y +Y F TL PI+ + +T+ + T TK K R+ Sbjct: 110 RRLMGLLSYFRRYVHNFATLAAPIYDL-LTEPKGGTSTKSKSRS 152 >SB_30749| Best HMM Match : FARP (HMM E-Value=0.032) Length = 2565 Score = 28.3 bits (60), Expect = 3.1 Identities = 19/73 (26%), Positives = 37/73 (50%) Frame = +3 Query: 138 KRYQVKFKRRREGKTDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWN 317 +RY++ +K+R G Y RKRL + +++K + +R ++ L K ++ R+ Sbjct: 736 RRYRLLYKKRPSGLQVRYGRKRLPI----VWRKRNYFVRIGGQSRQIFLSKKQIR-LRYQ 790 Query: 318 KRKLTLAERKNRI 356 R L L + R+ Sbjct: 791 GRLLKLPLTRLRV 803 >SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2463 Score = 28.3 bits (60), Expect = 3.1 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +2 Query: 269 QEERVKERLGQTEALEQTQANI---GREEKQNQAKE 367 QEE + E+ GQ + LEQT+ + G +KQ +KE Sbjct: 2250 QEEELDEQAGQIQILEQTKLRLEMAGERDKQLISKE 2285 >SB_13410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1984 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -1 Query: 169 RRLLNFTWYLLKYCLFFTTLTNPIF*I*VTKWRPQTDTKQKERN 38 RRL+ Y +Y F TL PI+ + +T+ + T TK K R+ Sbjct: 755 RRLMGLLSYFRRYVHNFATLAAPIYDL-LTEPKGGTSTKSKSRS 797 >SB_23651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1174 Score = 27.9 bits (59), Expect = 4.0 Identities = 21/76 (27%), Positives = 40/76 (52%) Frame = +3 Query: 141 RYQVKFKRRREGKTDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNK 320 R Q + K EG+ + RKRL + E +K + PS+++ +D+ K++ + Sbjct: 905 RLQDQNKENEEGEVSSWRRKRLEREREREKEKEKAEV---PSYRRNRF-QDAEKER--EQ 958 Query: 321 RKLTLAERKNRIKQKK 368 RK+ +ER + KQ++ Sbjct: 959 RKVRESERLEKEKQER 974 >SB_26400| Best HMM Match : RVT_1 (HMM E-Value=1.1e-30) Length = 1084 Score = 27.9 bits (59), Expect = 4.0 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = +3 Query: 180 TDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKR 323 +DY + + + ++ KK H +R PS K D + +K W R Sbjct: 605 SDYSLQLKADLTLDEAVKKQHNVVRGSPSISNKN-SVDKIGKKIWKHR 651 >SB_21831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 27.9 bits (59), Expect = 4.0 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 8/37 (21%) Frame = -1 Query: 364 FCLILFFLSAN--------VSLRLFQRFCLTESFFNS 278 FCL +FF+S + S+RLF+ FC+T S F S Sbjct: 242 FCLSIFFISKDKKEEVLHFFSIRLFKVFCVTLSGFTS 278 >SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048) Length = 1952 Score = 27.9 bits (59), Expect = 4.0 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 102 GFVKVVKNKQYFKRYQVKFKRRREGKTDY 188 GF++ +K + RY VK R R DY Sbjct: 1090 GFIEALKRRDVSSRYNVKHARFRRATNDY 1118 >SB_29552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 339 Score = 27.5 bits (58), Expect = 5.3 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -2 Query: 249 WLHGLSCRWLQSEQRGVYEHN-NQFS 175 ++HGLSC + E+ ++EHN N FS Sbjct: 16 YVHGLSCDAFRPEKYHLFEHNCNTFS 41 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 27.5 bits (58), Expect = 5.3 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 1/87 (1%) Frame = +3 Query: 147 QVKFKRRREGKT-DYYARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKR 323 Q K + + +G+ D + Q E +K E + + KK+ELK+ ++K K Sbjct: 259 QEKVEEKEKGEVEDAQTTEEEEKQKEEAERKKQEKLEK-LAKKKEELKERKRQEKLEQKA 317 Query: 324 KLTLAERKNRIKQKKASFIKRLQAQAE 404 K ER+ R K+K+ +R+Q + E Sbjct: 318 KKKEKERQEREKEKERE-KERIQQEKE 343 >SB_51415| Best HMM Match : zf-CCCH (HMM E-Value=1.1) Length = 332 Score = 27.5 bits (58), Expect = 5.3 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = +3 Query: 273 KKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQAQAE 404 K + K+D+VK+++ + RKL K R +Q+K I++ +A E Sbjct: 106 KPDCKQDAVKEQKPSGRKLKRKLYKQRKRQEKFKKIEKKKAIRE 149 >SB_50343| Best HMM Match : MAP (HMM E-Value=3.4) Length = 243 Score = 27.5 bits (58), Expect = 5.3 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +3 Query: 264 SHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKR 386 S K+++KK S+K++ KR + K R KK S KR Sbjct: 202 STNKRDIKKTSIKKRSMKKRSIKKRSMKKR-SIKKRSIKKR 241 >SB_35419| Best HMM Match : SMC_C (HMM E-Value=1.9e-05) Length = 867 Score = 27.1 bits (57), Expect = 7.1 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +3 Query: 243 EAIRADPSHKKKELKKDSVKQKRWNKRKLTLAE 341 EAI+ H+K+ELKK K+K K++ T+ E Sbjct: 549 EAIKE--KHQKQELKKQRFKEKMEKKQEETMVE 579 >SB_35415| Best HMM Match : BRF1 (HMM E-Value=4.4) Length = 408 Score = 27.1 bits (57), Expect = 7.1 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +3 Query: 225 IYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTL 335 + K+ EA + K+ ++D ++K+WNKR+ L Sbjct: 45 LMKQKTEAAKKQRISNKQARQEDQEERKKWNKRQAVL 81 >SB_26062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1535 Score = 27.1 bits (57), Expect = 7.1 Identities = 24/75 (32%), Positives = 37/75 (49%) Frame = +3 Query: 177 KTDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRI 356 K D KRL+ + + KK +++R KE +K + Q R NK L++R NR+ Sbjct: 926 KRDLKLEKRLLREQKKDLKKLKKSLR-------KERRKFAKTQARKNKVVEKLSKRLNRV 978 Query: 357 KQKKASFIKRLQAQA 401 K K F K+ + A Sbjct: 979 KIKN-KFRKKTKQSA 992 >SB_13895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.1 bits (57), Expect = 7.1 Identities = 14/76 (18%), Positives = 39/76 (51%) Frame = +3 Query: 120 KNKQYFKRYQVKFKRRREGKTDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKDSV 299 + ++Y R + +RR + Y +R+R + + I ++ + + R S ++ ++ + Sbjct: 42 QRRRYISRRRYISRRRYISRRRYISRRRYISRRRYISRRRYISRRRYISRRRYISRRRYI 101 Query: 300 KQKRWNKRKLTLAERK 347 ++R+ R+ +A R+ Sbjct: 102 SRRRYISRRRFIARRR 117 >SB_7120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 27.1 bits (57), Expect = 7.1 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 231 KKAHEAIRADPSHKKKELKKDSVKQK 308 KKA EA D +KKE KK K+K Sbjct: 521 KKAKEATEEDDGEEKKEKKKKKKKKK 546 >SB_56872| Best HMM Match : RVT_1 (HMM E-Value=2.7e-30) Length = 575 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +3 Query: 243 EAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIK 383 E I + HK + KD+ + ++K L L RKNR K + +K Sbjct: 486 EQILNEEGHKISQWYKDNFLKGNYDKYSLMLLGRKNRNKDNLSIQVK 532 >SB_53654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +3 Query: 243 EAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIK 383 E I + HK + KD+ + ++K L L RKNR K + +K Sbjct: 92 EQILNEEGHKISQWYKDNFLKGNYDKYSLMLLGRKNRNKDNLSIQVK 138 >SB_51640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 880 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +3 Query: 243 EAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIK 383 E I + HK + KD+ + ++K L L RKNR K + +K Sbjct: 663 EQILNEEGHKISQWYKDNFLKGNYDKYSLMLLGRKNRNKDNLSIQVK 709 >SB_46263| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) Length = 490 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +3 Query: 243 EAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIK 383 E I + HK + KD+ + ++K L L RKNR K + +K Sbjct: 292 EQILNEEGHKISQWYKDNFLKGNYDKYSLMLLGRKNRNKDNLSIQVK 338 >SB_34899| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00019) Length = 1136 Score = 26.6 bits (56), Expect = 9.3 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 4/79 (5%) Frame = +3 Query: 180 TDYYARKRLVVQIEAIYKKAHEAIR-ADPSHKKKELKKDSVKQKR---WNKRKLTLAERK 347 ++Y V +E + EA+R + +H++ K S ++R W K+K + E Sbjct: 397 SEYSRTTERVDHLEDVLANKEEALRNSQDAHEQTVAKLSSAIKERETSWKKQKAEIEEHY 456 Query: 348 NRIKQKKASFIKRLQAQAE 404 N+I + K+ Q A+ Sbjct: 457 NKIINDLQNRTKKTQNLAD 475 >SB_34436| Best HMM Match : SAM_1 (HMM E-Value=5.1) Length = 119 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +3 Query: 243 EAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIK 383 E I + HK + KD+ + ++K L L RKNR K + +K Sbjct: 30 EQILNEEGHKISQWYKDNFLKGNYDKYSLMLLGRKNRNKDNLSIQVK 76 >SB_32921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +3 Query: 243 EAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIK 383 E I + HK + KD+ + ++K L L RKNR K + +K Sbjct: 30 EQILNEEGHKISQWYKDNFLKGNYDKYSLMLLGRKNRNKDNLSLQVK 76 >SB_30986| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 2682 Score = 26.6 bits (56), Expect = 9.3 Identities = 18/74 (24%), Positives = 34/74 (45%), Gaps = 2/74 (2%) Frame = +3 Query: 168 REGKTDYYARKRLVVQIEAIYKKAHEAIRA--DPSHKKKELKKDSVKQKRWNKRKLTLAE 341 RE ++ YA + V +K A+ A DP+ + K ++ +K KRKL + Sbjct: 1086 REAMSEVYASLQHGVMETKEKRKRQRALEAVADPAESARRKFKRNLSKKETRKRKLDALK 1145 Query: 342 RKNRIKQKKASFIK 383 ++K+ ++ K Sbjct: 1146 PDRKMKRARSKVEK 1159 >SB_19150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 537 Score = 26.6 bits (56), Expect = 9.3 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = +2 Query: 338 REEKQNQAKEGFLHQETAGSGG--SLNALNIIFE 433 R +N +K F HQE G+G S AL ++FE Sbjct: 378 RPGNENLSKAYFWHQEAPGNGSIESQGALGVMFE 411 >SB_17803| Best HMM Match : SRCR (HMM E-Value=0) Length = 1428 Score = 26.6 bits (56), Expect = 9.3 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 160 RGVVKGKLIIMLVNASLFRLKPSTRKPMKPSVRIHP 267 R V G + + LV LFRL +R P + RI+P Sbjct: 1381 RLVTLGLVTLGLVTLGLFRLDHESRHPQNRNFRINP 1416 >SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2672 Score = 26.6 bits (56), Expect = 9.3 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +3 Query: 213 QIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERK 347 ++E IY E + S K ++L+KD K+ + K +L LAE K Sbjct: 1883 ELETIYNSKIEDLNLAKS-KIEKLEKDHEKESEFLKVQLLLAEEK 1926 >SB_16177| Best HMM Match : SAM_1 (HMM E-Value=5.1) Length = 181 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +3 Query: 243 EAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIK 383 E I + HK + KD+ + ++K L L RKNR K + +K Sbjct: 92 EQILNEEGHKISQWYKDNFLKGNYDKYSLMLLGRKNRNKDNLSIQVK 138 >SB_15224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1060 Score = 26.6 bits (56), Expect = 9.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 261 DPHGWLHGLSCRWLQSEQRG 202 + HGWL + WL SE RG Sbjct: 644 ETHGWLPSETLGWLPSETRG 663 Score = 26.6 bits (56), Expect = 9.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 261 DPHGWLHGLSCRWLQSEQRG 202 + HGWL + WL SE RG Sbjct: 684 ETHGWLPSETHEWLPSETRG 703 >SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) Length = 2072 Score = 26.6 bits (56), Expect = 9.3 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 5/92 (5%) Frame = +3 Query: 123 NKQYFKRYQVKFKRRREGKTDYY-ARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKDSV 299 NKQ +R++ ++KRR +G D A R + E E D + E +K+ V Sbjct: 1349 NKQEIERWKNEYKRRIDGLEDQLEAETRKMKHAEEALLLEREKSIQDKKNGLAEFEKEKV 1408 Query: 300 K-QKRWNKRKLTLAERKNRI---KQKKASFIK 383 +R+N R + ++ + QKK S ++ Sbjct: 1409 AIYQRFNDRIAAVESERDILVSDYQKKISSLR 1440 >SB_2863| Best HMM Match : Asp (HMM E-Value=1.2e-07) Length = 721 Score = 26.6 bits (56), Expect = 9.3 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = -3 Query: 167 TPLEFYLVPLEVLFVLHNFNESHILNLSYKVASTDGHQAKRKELLL 30 T +EF ++ E F L N IL L+Y+ +TDG +L+L Sbjct: 334 TLVEFAVIRNEKDFFLRNSINEGILGLAYRSLATDGVTPLYDQLVL 379 >SB_1096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 26.6 bits (56), Expect = 9.3 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +2 Query: 266 PQEERVKERLGQTEALEQTQANIGREEKQNQAKEGFLHQE 385 PQE+ +K +L + L + G EE+ N+ + H++ Sbjct: 50 PQEKSMKNQLNEIRYLRWLLMSKGTEERLNEVRSDIRHEK 89 >SB_1034| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) Length = 558 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +3 Query: 243 EAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIK 383 E I + HK + KD+ + ++K L L RKNR K + +K Sbjct: 292 EQILNEEGHKISQWYKDNFLKGNYDKYSLMLLGRKNRNKDNLSIQVK 338 >SB_913| Best HMM Match : E-MAP-115 (HMM E-Value=1.7) Length = 856 Score = 26.6 bits (56), Expect = 9.3 Identities = 16/65 (24%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = +3 Query: 120 KNKQYFKRYQVKFKRRREGKTDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKELKKD-S 296 +NK++ ++ +FK+ + + ++R+ EA KK ++ AD K + LK+ Sbjct: 24 RNKRWREKKGAEFKKAESQRIEKRRKRRVTEMSEADLKK-YKMAAADRKRKSRMLKRQKE 82 Query: 297 VKQKR 311 V++ R Sbjct: 83 VEESR 87 >SB_59736| Best HMM Match : RVT_1 (HMM E-Value=8.2e-31) Length = 326 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +3 Query: 243 EAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIK 383 E I + HK + KD+ + ++K L L RKNR K + +K Sbjct: 237 EQILNEEGHKISQWYKDNFLKGNYDKYSLMLLGRKNRNKDNLSIQVK 283 >SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) Length = 591 Score = 26.6 bits (56), Expect = 9.3 Identities = 23/91 (25%), Positives = 41/91 (45%), Gaps = 3/91 (3%) Frame = +3 Query: 111 KVVKNKQYFKRYQVKFKRRREGKTDYYARKRLVVQIEAIYKKAHEAIRADPSHKKKELKK 290 K +K ++ + + + K E + ++ Q EA + + + + K+ KK Sbjct: 442 KRIKEEEARLKEERRSKDEEENRRKADEERKRKEQEEAERNRVVQEEKRKIEQEGKQRKK 501 Query: 291 DSVKQKRWNKRKLTL---AERKNRIKQKKAS 374 +S KQ+ NK++ L AE N KQK S Sbjct: 502 ESRKQEEQNKKEQILNKMAEPTNIRKQKSTS 532 >SB_43536| Best HMM Match : DUF1410 (HMM E-Value=3.5) Length = 344 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +3 Query: 243 EAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIK 383 E I + HK + KD+ + ++K L L RKNR K + +K Sbjct: 103 EQILNEEGHKISQWYKDNFLKGNYDKYSLMLLGRKNRNKDNLSIQVK 149 >SB_43054| Best HMM Match : SAM_1 (HMM E-Value=5.2) Length = 119 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +3 Query: 243 EAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIK 383 E I + HK + KD+ + ++K L L RKNR K + +K Sbjct: 30 EQILNEEGHKISQWYKDNFLKGNYDKYSLMLLGRKNRKKDNLSIQVK 76 >SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) Length = 374 Score = 26.6 bits (56), Expect = 9.3 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +2 Query: 263 IPQEERVKERLGQTEALEQTQANIGREEKQNQAKE 367 I QEE +ER + + + + + REE++ +AKE Sbjct: 191 IAQEEMRREREEEENRILEEEERVKREEEEKKAKE 225 Score = 26.6 bits (56), Expect = 9.3 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +2 Query: 263 IPQEERVKERLGQTEALEQTQANIGREEKQNQAKE 367 + +EERVK + +A E + +G +E+Q + KE Sbjct: 208 LEEEERVKREEEEKKAKEVEEKRMGEDEEQIKLKE 242 >SB_40130| Best HMM Match : SAM_1 (HMM E-Value=5.1) Length = 181 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +3 Query: 243 EAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIK 383 E I + HK + KD+ + ++K L L RKNR K + +K Sbjct: 92 EQILNEEGHKISQWYKDNFLKGNYDKYSLMLLGRKNRNKDNLSIQVK 138 >SB_18267| Best HMM Match : SAM_1 (HMM E-Value=5.1) Length = 106 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +3 Query: 243 EAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIK 383 E I + HK + KD+ + ++K L L RKNR K + +K Sbjct: 19 EQILNEEGHKISQWYKDNFLKGNYDKYSLMLLGRKNRNKDNLSIQVK 65 >SB_9039| Best HMM Match : M (HMM E-Value=0.00046) Length = 716 Score = 26.6 bits (56), Expect = 9.3 Identities = 20/64 (31%), Positives = 38/64 (59%), Gaps = 6/64 (9%) Frame = +3 Query: 231 KKAHEAIRA----DPSHKKKELKKD--SVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQ 392 ++ HE + A D + K+K L+ D SV+ + N+R+ +R+ K+++A +KR+Q Sbjct: 472 QEEHEEVMAELAQDCADKRKMLQDDIASVESRLSNERQQVEQQRQQLEKEQEA--LKRVQ 529 Query: 393 AQAE 404 A+ E Sbjct: 530 AELE 533 >SB_867| Best HMM Match : Leo1 (HMM E-Value=0) Length = 591 Score = 26.6 bits (56), Expect = 9.3 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +2 Query: 263 IPQEERVKERLGQTEALEQTQANIGREEKQNQAKE 367 + +E ++ + E+ E+TQA + REE + + +E Sbjct: 276 LSSDEEKEDNAREVESKEETQARVPREEGEEEEEE 310 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,025,487 Number of Sequences: 59808 Number of extensions: 240241 Number of successful extensions: 1336 Number of sequences better than 10.0: 77 Number of HSP's better than 10.0 without gapping: 1064 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1262 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 883875528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -