BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10j21 (220 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42686| Best HMM Match : Pkinase (HMM E-Value=0) 44 1e-05 SB_51111| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-05 SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 5e-05 SB_54290| Best HMM Match : Pkinase (HMM E-Value=1.3e-26) 41 1e-04 SB_24175| Best HMM Match : Pkinase (HMM E-Value=6.2e-07) 41 1e-04 SB_39043| Best HMM Match : Pkinase (HMM E-Value=2.7e-09) 40 2e-04 SB_31698| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 2e-04 SB_11825| Best HMM Match : Pkinase (HMM E-Value=1.2e-17) 40 2e-04 SB_18299| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 2e-04 SB_22253| Best HMM Match : Pkinase (HMM E-Value=0) 39 6e-04 SB_15979| Best HMM Match : Pkinase (HMM E-Value=0) 39 6e-04 SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 7e-04 SB_57581| Best HMM Match : Pkinase (HMM E-Value=4.7e-24) 39 7e-04 SB_33829| Best HMM Match : Pkinase (HMM E-Value=0) 38 0.001 SB_11460| Best HMM Match : Pkinase (HMM E-Value=0) 38 0.001 SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) 38 0.002 SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.003 SB_32519| Best HMM Match : Pkinase (HMM E-Value=7.3e-39) 37 0.003 SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.004 SB_17500| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.004 SB_37647| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.004 SB_33732| Best HMM Match : Pkinase (HMM E-Value=9e-10) 36 0.005 SB_17930| Best HMM Match : Pkinase (HMM E-Value=0) 36 0.005 SB_53776| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.5e-12) 36 0.005 SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) 36 0.005 SB_18697| Best HMM Match : Pkinase (HMM E-Value=5.9e-07) 36 0.007 SB_18269| Best HMM Match : CUB (HMM E-Value=7.4e-37) 36 0.007 SB_37321| Best HMM Match : Pkinase (HMM E-Value=2.4e-27) 36 0.007 SB_9887| Best HMM Match : Pkinase (HMM E-Value=4.1e-37) 35 0.009 SB_47948| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.009 SB_14304| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.012 SB_25818| Best HMM Match : Pkinase (HMM E-Value=1.7e-20) 34 0.016 SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.021 SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) 34 0.021 SB_46550| Best HMM Match : Asn_synthase (HMM E-Value=0) 33 0.028 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 33 0.028 SB_26127| Best HMM Match : Pkinase (HMM E-Value=5.3e-10) 33 0.028 SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) 33 0.028 SB_3739| Best HMM Match : Pkinase (HMM E-Value=0) 33 0.028 SB_36661| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.037 SB_24478| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.037 SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.037 SB_35776| Best HMM Match : Pkinase (HMM E-Value=0) 33 0.049 SB_36983| Best HMM Match : Pkinase (HMM E-Value=6.4e-22) 32 0.065 SB_34086| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.065 SB_32748| Best HMM Match : Pkinase (HMM E-Value=7.8e-26) 32 0.065 SB_28695| Best HMM Match : Ras (HMM E-Value=0) 32 0.065 SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.085 SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) 32 0.085 SB_5779| Best HMM Match : Pkinase (HMM E-Value=1.8e-19) 32 0.085 SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 31 0.11 SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.11 SB_19466| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.11 SB_56812| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.3e-06) 31 0.15 SB_26356| Best HMM Match : Pkinase (HMM E-Value=0.00044) 31 0.15 SB_38378| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 31 0.15 SB_3002| Best HMM Match : Pkinase (HMM E-Value=4.1e-17) 31 0.15 SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.20 SB_31696| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.20 SB_1621| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.20 SB_26967| Best HMM Match : Pkinase (HMM E-Value=0) 31 0.20 SB_1165| Best HMM Match : Pkinase (HMM E-Value=5.6e-23) 31 0.20 SB_46497| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.34 SB_58677| Best HMM Match : Pkinase (HMM E-Value=2.8e-33) 29 0.46 SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) 29 0.46 SB_25790| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.46 SB_13192| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.46 SB_34303| Best HMM Match : Pkinase (HMM E-Value=0) 29 0.60 SB_19291| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.60 SB_51259| Best HMM Match : Pkinase_Tyr (HMM E-Value=3.4e-08) 29 0.60 SB_41851| Best HMM Match : Pkinase (HMM E-Value=0) 29 0.80 SB_36782| Best HMM Match : Pkinase (HMM E-Value=1.4e-32) 29 0.80 SB_3250| Best HMM Match : Pkinase (HMM E-Value=1e-09) 29 0.80 SB_58868| Best HMM Match : Pkinase (HMM E-Value=1.9e-32) 29 0.80 SB_11275| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.0005) 29 0.80 SB_51685| Best HMM Match : Pkinase (HMM E-Value=0) 28 1.1 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 28 1.4 SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.4 SB_13922| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.4 SB_2079| Best HMM Match : Pkinase (HMM E-Value=4.2e-10) 28 1.4 SB_38918| Best HMM Match : DUF997 (HMM E-Value=2.3) 27 1.8 SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) 27 1.8 SB_10682| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) 27 1.8 SB_11865| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.7e-07) 27 1.8 SB_10367| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_53183| Best HMM Match : Ras (HMM E-Value=0) 27 2.4 SB_40595| Best HMM Match : Pkinase (HMM E-Value=3.4e-08) 27 2.4 SB_16221| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.4 SB_27678| Best HMM Match : Pkinase (HMM E-Value=0) 27 3.2 SB_19615| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_57461| Best HMM Match : Pkinase (HMM E-Value=1.1e-34) 27 3.2 SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_14271| Best HMM Match : Pkinase (HMM E-Value=2.1e-27) 26 4.2 SB_53368| Best HMM Match : CLN3 (HMM E-Value=1.4e-07) 26 4.2 SB_4877| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_51803| Best HMM Match : Ion_trans_2 (HMM E-Value=2.3e-30) 26 5.6 SB_27024| Best HMM Match : Pkinase (HMM E-Value=4.7e-25) 26 5.6 SB_12792| Best HMM Match : Pkinase (HMM E-Value=1.1e-09) 26 5.6 SB_6123| Best HMM Match : MutS_III (HMM E-Value=1.8e-09) 26 5.6 SB_13067| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_8123| Best HMM Match : Tfb2 (HMM E-Value=0.00019) 26 5.6 SB_6592| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_56328| Best HMM Match : NHL (HMM E-Value=0.082) 25 7.4 SB_43494| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_30262| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_28310| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_8812| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_46446| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_40655| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_25595| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_25445| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.4 SB_52903| Best HMM Match : DUF1126 (HMM E-Value=0) 25 9.8 SB_48964| Best HMM Match : TRAP_240kDa (HMM E-Value=0) 25 9.8 SB_21129| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) 25 9.8 SB_20165| Best HMM Match : Pkinase (HMM E-Value=0.00013) 25 9.8 >SB_42686| Best HMM Match : Pkinase (HMM E-Value=0) Length = 759 Score = 44.4 bits (100), Expect = 1e-05 Identities = 18/69 (26%), Positives = 37/69 (53%) Frame = -2 Query: 210 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 31 ++++ ++ +VM+ I DLF+ + + + + + R +C+AL LHK + Sbjct: 506 VRLFEDYDSATEIYLVMELIKGGDLFDAISSSVKFTEHVAKSYFRDMCKALAYLHKRKIV 565 Query: 30 HNDIKLENV 4 H D+K EN+ Sbjct: 566 HRDLKPENL 574 >SB_51111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 44.4 bits (100), Expect = 1e-05 Identities = 19/56 (33%), Positives = 33/56 (58%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENVF 1 IVM+Y +LF + +G+L ++ + Q+ A+ +H ++ IH D+K ENVF Sbjct: 135 IVMEYACGGELFAKISNEGKLPERIAKKLYGQVLSAVEHMHDNDIIHRDLKAENVF 190 >SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1184 Score = 42.7 bits (96), Expect = 5e-05 Identities = 21/69 (30%), Positives = 34/69 (49%) Frame = -2 Query: 210 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 31 +K+Y++ N VMDY+ DL L G I +L A++ +H+ F+ Sbjct: 717 VKLYYSFQDQENLYFVMDYVPGGDLMSLLIKFGIFPEDYAKFYIAELVLAIDSVHRMGFV 776 Query: 30 HNDIKLENV 4 H DIK +N+ Sbjct: 777 HRDIKPDNI 785 >SB_54290| Best HMM Match : Pkinase (HMM E-Value=1.3e-26) Length = 239 Score = 41.1 bits (92), Expect = 1e-04 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIK-GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 +V +Y+D DL L+ L+ + + IRQL + LN HK NF+H DIK N+ Sbjct: 62 LVFEYMD-HDLMGLLESGLVHLTEDHIKSFIRQLLDGLNYCHKKNFLHRDIKCSNI 116 >SB_24175| Best HMM Match : Pkinase (HMM E-Value=6.2e-07) Length = 268 Score = 41.1 bits (92), Expect = 1e-04 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 3/62 (4%) Frame = -2 Query: 180 NNQVIVMDY-IDCPDLFETLQIK--GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLE 10 + VIVM+ C DLF LQI+ G + ++ I R + ++ L K +HNDIK E Sbjct: 129 SRHVIVMERPAHCLDLFSFLQIQPQGRVKEKVARKIFRDVMRGVDYLDKRGILHNDIKPE 188 Query: 9 NV 4 N+ Sbjct: 189 NI 190 >SB_39043| Best HMM Match : Pkinase (HMM E-Value=2.7e-09) Length = 239 Score = 40.3 bits (90), Expect = 2e-04 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 3/62 (4%) Frame = -2 Query: 180 NNQVIVMDY-IDCPDLFETLQIK--GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLE 10 + VIVM+ C DLF L+I+ G + ++ I R + ++ L K +HNDIK E Sbjct: 37 SRHVIVMERPAQCLDLFSFLEIQPQGRVKEKVARKIFRDVMRGVDYLDKRGILHNDIKPE 96 Query: 9 NV 4 N+ Sbjct: 97 NI 98 >SB_31698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 40.3 bits (90), Expect = 2e-04 Identities = 15/56 (26%), Positives = 34/56 (60%) Frame = -2 Query: 171 VIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 +++M+++ +LFE + L+ + V +RQ+ + + +H+ + +H D+K ENV Sbjct: 124 IVIMEFVSGGELFEKICNDDNLTEKEVIRYMRQILQGVEHMHRKSIVHLDLKPENV 179 >SB_11825| Best HMM Match : Pkinase (HMM E-Value=1.2e-17) Length = 181 Score = 40.3 bits (90), Expect = 2e-04 Identities = 18/58 (31%), Positives = 35/58 (60%) Frame = -2 Query: 177 NQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 N V++M++I +LFE + + L+ + + + QL + + +HK N +H D+K EN+ Sbjct: 70 NIVMIMEFISGGELFERVVDEDCLTEKEAAYYMHQLLQGIEHVHKKNVLHLDLKPENI 127 >SB_18299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 40.3 bits (90), Expect = 2e-04 Identities = 19/55 (34%), Positives = 33/55 (60%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 +VM+ + DLFE + + + S+++R L AL+ LH ++ +H DIK EN+ Sbjct: 93 LVMELVKGGDLFEAIVEATKYTEVHASHMVRDLASALDYLHCNSIVHRDIKPENL 147 >SB_22253| Best HMM Match : Pkinase (HMM E-Value=0) Length = 870 Score = 39.1 bits (87), Expect = 6e-04 Identities = 16/55 (29%), Positives = 30/55 (54%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 +V +++D L + + L V ++ Q+ A+ +H+HN IH D+K EN+ Sbjct: 22 LVFEFVDHTVLDDLERYPNGLDENTVRKVMWQVLRAIEFIHRHNIIHRDVKPENI 76 >SB_15979| Best HMM Match : Pkinase (HMM E-Value=0) Length = 367 Score = 39.1 bits (87), Expect = 6e-04 Identities = 17/58 (29%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = -2 Query: 171 VIVMDYIDCPDLFETL-QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENVF 1 +I M+Y D L + L +++ ++ + + N+ +Q+ AL +H +N +H D+K N+F Sbjct: 102 MIEMEYADGGTLAQYLTKLEKDMEEKDILNMFQQMLSALKYIHNNNILHRDLKTANIF 159 >SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 38.7 bits (86), Expect = 7e-04 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGE--LSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 +V +YI +L ++ E LS I+RQ+ AL+ LH+ +H D+K+EN+ Sbjct: 91 LVTEYIPGGELLGLIRSHQESRLSETQARPIVRQIVSALHHLHEQGIVHRDLKMENI 147 >SB_57581| Best HMM Match : Pkinase (HMM E-Value=4.7e-24) Length = 235 Score = 38.7 bits (86), Expect = 7e-04 Identities = 17/52 (32%), Positives = 30/52 (57%) Frame = -2 Query: 159 DYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 D + +LF+ + KG + Q S +++Q+ EA + LH +H D+K EN+ Sbjct: 89 DSVQGGELFDRIVEKGNYTEQDASALVQQILEAADYLHSLGIVHRDLKPENL 140 >SB_33829| Best HMM Match : Pkinase (HMM E-Value=0) Length = 290 Score = 38.3 bits (85), Expect = 0.001 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 I++D D DL E ++ G + QL +A+ LH +H D+K EN+ Sbjct: 67 IILDLADNGDLLEYIRSNGAIPENEARLFYHQLVDAVEYLHNKGVVHRDLKCENI 121 >SB_11460| Best HMM Match : Pkinase (HMM E-Value=0) Length = 323 Score = 38.3 bits (85), Expect = 0.001 Identities = 15/55 (27%), Positives = 30/55 (54%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 I+ D + DL E ++ G L+ + + RQ+ ++ +H + +H D+K EN+ Sbjct: 127 IITDLAENGDLLEYIRTHGALTEKASRRLFRQITAGVHYIHSQDIVHRDLKCENL 181 >SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) Length = 1023 Score = 37.5 bits (83), Expect = 0.002 Identities = 19/59 (32%), Positives = 32/59 (54%) Frame = -2 Query: 177 NQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENVF 1 N I+++ L + L+ +G+L+ V ++Q EA + LH+ IH DIK+ N F Sbjct: 505 NFYILLELCSRKSLVQMLKTRGKLTEPEVRFFMQQAIEACSYLHEQRVIHRDIKVGNFF 563 >SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 920 Score = 36.7 bits (81), Expect = 0.003 Identities = 19/69 (27%), Positives = 34/69 (49%) Frame = -2 Query: 210 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 31 +K+Y N +V DY + ++F+ L G L + Q+ A++ HK + + Sbjct: 217 VKLYQVMETKNMLYLVTDYANNGEMFDYLAHHGRLPEKEARKKFVQILSAVDYCHKRHVV 276 Query: 30 HNDIKLENV 4 H D+K EN+ Sbjct: 277 HRDLKAENL 285 >SB_32519| Best HMM Match : Pkinase (HMM E-Value=7.3e-39) Length = 1486 Score = 36.7 bits (81), Expect = 0.003 Identities = 18/59 (30%), Positives = 29/59 (49%) Frame = -2 Query: 180 NNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 N +V + DL + + + L V IRQ+ A+ LH+ IH D+K+EN+ Sbjct: 253 NRYYLVFELAGGGDLMDYICYRKRLGETEVRKFIRQIISAVQYLHQGGIIHRDLKVENL 311 >SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1287 Score = 36.3 bits (80), Expect = 0.004 Identities = 16/55 (29%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = -2 Query: 165 VMDYIDCPDLFETLQIKGEL-SHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 V +Y+ +L++ ++ + +L ++ N+I Q+ + L +HKH + H D+K EN+ Sbjct: 44 VFEYMK-ENLYQMMKNRDKLLPESVIRNVIYQILQGLAFIHKHGYFHRDMKPENL 97 >SB_17500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 36.3 bits (80), Expect = 0.004 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 ++M+Y+ LF+ + + S + + RQL AL LH +H DIK +N+ Sbjct: 103 LIMEYVAGGSLFDEVIQQTYYSEKQARLVTRQLLNALEYLHSRRIVHRDIKPDNL 157 >SB_37647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 666 Score = 36.3 bits (80), Expect = 0.004 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 3/62 (4%) Frame = -2 Query: 180 NNQVIVMDY-IDCPDLFETLQI--KGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLE 10 + VIVM+ C DLF L+I +G + + I R + + L + +HNDIK E Sbjct: 487 SRHVIVMERPAHCLDLFSFLEIQPRGRVKEKGARKIFRDVMRGVKYLDQRGILHNDIKPE 546 Query: 9 NV 4 N+ Sbjct: 547 NI 548 >SB_33732| Best HMM Match : Pkinase (HMM E-Value=9e-10) Length = 322 Score = 35.9 bits (79), Expect = 0.005 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 ++++Y +L++ L + + + IRQL +AL H IH DIK EN+ Sbjct: 104 LILEYAPRGELYKELTACEKFDEKRAAKYIRQLADALAYCHSKKVIHRDIKPENL 158 >SB_17930| Best HMM Match : Pkinase (HMM E-Value=0) Length = 286 Score = 35.9 bits (79), Expect = 0.005 Identities = 18/54 (33%), Positives = 29/54 (53%) Frame = -2 Query: 165 VMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 V++Y+ DL +Q + L ++C ALN LH+ I+ D+KL+NV Sbjct: 102 VIEYVSGGDLMYHMQRQRRLPEDHARFYSAEICCALNFLHEKGVIYRDLKLDNV 155 >SB_53776| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.5e-12) Length = 640 Score = 35.9 bits (79), Expect = 0.005 Identities = 16/51 (31%), Positives = 29/51 (56%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 16 +VM+Y LFE L+ E++ +L+ Q+ + ++ LH + IH D+K Sbjct: 174 VVMEYCPYGQLFEVLRDGREITPELLVGWTTQIADGMHYLHGNKIIHRDLK 224 >SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) Length = 937 Score = 35.9 bits (79), Expect = 0.005 Identities = 16/55 (29%), Positives = 29/55 (52%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 +VM+Y ++F+ L G + + RQ+ A+ H+ + IH D+K EN+ Sbjct: 157 LVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHVIHRDLKAENL 211 >SB_18697| Best HMM Match : Pkinase (HMM E-Value=5.9e-07) Length = 216 Score = 35.5 bits (78), Expect = 0.007 Identities = 16/52 (30%), Positives = 30/52 (57%) Frame = -2 Query: 171 VIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 16 VI+MD ++ + E L K + + + ++RQ +AL LH +N +H D++ Sbjct: 116 VIMMDIVEGKNCLEFLGDKPRANEEDAAFVMRQTLDALKYLHSNNIVHLDVR 167 >SB_18269| Best HMM Match : CUB (HMM E-Value=7.4e-37) Length = 1655 Score = 35.5 bits (78), Expect = 0.007 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = -2 Query: 171 VIVMDYIDCPDLFETLQIK-GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENVF 1 ++ D++ L L+ K GELS V + L +AL +LH H +HN I +VF Sbjct: 1524 LLCFDFVSNTTLDAFLREKEGELSLDCVCAVAIDLSDALIELHNHGVVHNAISASSVF 1581 >SB_37321| Best HMM Match : Pkinase (HMM E-Value=2.4e-27) Length = 592 Score = 35.5 bits (78), Expect = 0.007 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = -2 Query: 105 SHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 S + V ++RQ+ E + LHK N++H DIK N+ Sbjct: 250 SEKEVVYLLRQILEGIRHLHKQNYVHLDIKPNNI 283 >SB_9887| Best HMM Match : Pkinase (HMM E-Value=4.1e-37) Length = 256 Score = 35.1 bits (77), Expect = 0.009 Identities = 18/69 (26%), Positives = 35/69 (50%) Frame = -2 Query: 210 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 31 +K+Y++ +VM+++ DL L K + + I + A++ +H+ FI Sbjct: 111 VKMYYSFQDDYYLFLVMEFLPGGDLMTLLMKKDTFTEEETRFYIAEALLAIDSIHQLGFI 170 Query: 30 HNDIKLENV 4 H DIK +N+ Sbjct: 171 HRDIKPDNL 179 >SB_47948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 641 Score = 35.1 bits (77), Expect = 0.009 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 3/67 (4%) Frame = -2 Query: 192 HGFINNQVIVMDYID-CP--DLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHND 22 HG+ ++ + ++ CP L E + + L+ V ++Q+ +A LHK IH D Sbjct: 104 HGYFEDRDYIYILLELCPRRSLMELHKRRRALTEPEVRYFMKQIIDACIYLHKSRIIHRD 163 Query: 21 IKLENVF 1 +KL N+F Sbjct: 164 LKLGNLF 170 >SB_14304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1219 Score = 34.7 bits (76), Expect = 0.012 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 +V++ DL + LQ K +L I +++ + + H+ H D+KLEN+ Sbjct: 144 LVLELAQNGDLLQLLQKKKQLHENEARKIFKKIVKGVLHCHRKGIAHRDLKLENI 198 >SB_25818| Best HMM Match : Pkinase (HMM E-Value=1.7e-20) Length = 956 Score = 34.3 bits (75), Expect = 0.016 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = -2 Query: 117 KGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 +G L +++ ++R++ + L HK+ IH D+K N+ Sbjct: 797 EGVLEEDIIATVLREVLKGLEYFHKNGLIHRDVKAGNI 834 >SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1142 Score = 33.9 bits (74), Expect = 0.021 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = -2 Query: 126 LQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 L+++ L+ + + RQL E L LH H IH D+K N+ Sbjct: 320 LELERGLNEPEIRAVTRQLFEGLQFLHNHKVIHRDLKAGNL 360 >SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) Length = 964 Score = 33.9 bits (74), Expect = 0.021 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = -2 Query: 171 VIVMDYIDCPDLFETLQIKGE--LSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 +IVM+Y +++ LQ +G + + + Q+ AL +HK +H D+K +N+ Sbjct: 77 MIVMEYAQGGTIYDYLQQRGGKLMDEDEILRLFVQILLALRHVHKGQILHRDLKTQNI 134 >SB_46550| Best HMM Match : Asn_synthase (HMM E-Value=0) Length = 1663 Score = 33.5 bits (73), Expect = 0.028 Identities = 15/55 (27%), Positives = 29/55 (52%) Frame = -2 Query: 177 NQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKL 13 N +IV + + LF+ L + L+ ++ + Q+ E + LH N +H D+K+ Sbjct: 1161 NYIIVTELLAGGRLFDYLVVMDALTEKVAIGYMHQVVEGVQHLHDLNIVHLDLKM 1215 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 33.5 bits (73), Expect = 0.028 Identities = 16/59 (27%), Positives = 30/59 (50%) Frame = -2 Query: 180 NNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 N+ ++M+Y DL + K L ++ +RQL AL + ++ H D+K +N+ Sbjct: 128 NHIFLIMEYCGGGDLSRFIHSKRALPERMARKFLRQLACALQYMRSYDVAHMDLKPQNL 186 >SB_26127| Best HMM Match : Pkinase (HMM E-Value=5.3e-10) Length = 460 Score = 33.5 bits (73), Expect = 0.028 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 4/64 (6%) Frame = -2 Query: 180 NNQVIVMDYIDCPDLFETLQIKGELSHQL----VSNIIRQLCEALNDLHKHNFIHNDIKL 13 N+ +I +Y D L + +Q +L +L + ++ QL + L +H + +H DIK Sbjct: 207 NHMLIQNEYCDGGSLADRIQSNNKLGERLSEADLKMLLLQLAQGLKYIHSLHLVHMDIKP 266 Query: 12 ENVF 1 N+F Sbjct: 267 GNIF 270 >SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) Length = 476 Score = 33.5 bits (73), Expect = 0.028 Identities = 15/55 (27%), Positives = 30/55 (54%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 +V D + +LFE + + S S+ I+Q+ ++ H++ +H D+K EN+ Sbjct: 91 LVFDLVTGGELFEDIVAREYYSEADASHCIQQVLLSVQHCHENGIVHRDLKPENL 145 >SB_3739| Best HMM Match : Pkinase (HMM E-Value=0) Length = 490 Score = 33.5 bits (73), Expect = 0.028 Identities = 18/69 (26%), Positives = 38/69 (55%) Frame = -2 Query: 210 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 31 +++Y +H + +VM++++ L + + LS + V+ + R + +AL LH I Sbjct: 276 VEMYGSHLVGDELWVVMEFLEGGTLTDIVT-HTNLSEEQVACVCRAVLKALTFLHSQGVI 334 Query: 30 HNDIKLENV 4 H DIK +++ Sbjct: 335 HRDIKSDSI 343 >SB_36661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 33.1 bits (72), Expect = 0.037 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 90 SNIIRQLCEALNDLHKHNFIHNDIKLENV 4 S ++ +C AL+ LHK H D+K EN+ Sbjct: 196 SLVVNDICSALDFLHKQGIAHRDLKPENI 224 >SB_24478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 747 Score = 33.1 bits (72), Expect = 0.037 Identities = 19/56 (33%), Positives = 31/56 (55%) Frame = -2 Query: 171 VIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 ++VMD + DL++ IK LS + ++ + E + LH +H DIKL+NV Sbjct: 544 LLVMDRLQ-RDLYQG--IKAGLSFRARMHVAVDVVEGIRFLHSQGLVHRDIKLKNV 596 >SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1822 Score = 33.1 bits (72), Expect = 0.037 Identities = 15/56 (26%), Positives = 28/56 (50%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENVF 1 I M+Y + L + + + + V ++R++ E L +H IH D+K N+F Sbjct: 1051 IQMEYCEKSTLRDVIDMGLHTNTDRVWRLLREIVEGLAHIHSQGIIHRDLKPVNIF 1106 >SB_35776| Best HMM Match : Pkinase (HMM E-Value=0) Length = 558 Score = 32.7 bits (71), Expect = 0.049 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNI-IRQLCEALNDLHKHNFIHNDIKLENV 4 +VMDY DL L ++ + ++ + ++ A++ LH F+H D+K +NV Sbjct: 156 LVMDYHPGGDLLSLLSKYDDIFEEDMARFYLAEIVMAIHSLHTMGFVHRDVKPDNV 211 >SB_36983| Best HMM Match : Pkinase (HMM E-Value=6.4e-22) Length = 331 Score = 32.3 bits (70), Expect = 0.065 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 3/61 (4%) Frame = -2 Query: 177 NQVIVMDYIDCPDLFETLQIKGE---LSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLEN 7 N++IVM+ LF L+ LS Q +IR + + LH + +H D+K N Sbjct: 83 NEIIVMELCSGGSLFTMLEHPSNAYGLSEQDCIAVIRDVVAGMKHLHDNGIVHRDLKPGN 142 Query: 6 V 4 + Sbjct: 143 I 143 >SB_34086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 890 Score = 32.3 bits (70), Expect = 0.065 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -2 Query: 123 QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLEN 7 Q KG SH + + Q+ +++ +H+ F+H DIK N Sbjct: 15 QPKGVFSHSTMLRLGTQILKSVKSIHEAGFLHRDIKPSN 53 >SB_32748| Best HMM Match : Pkinase (HMM E-Value=7.8e-26) Length = 187 Score = 32.3 bits (70), Expect = 0.065 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 +VM+Y++ D L+ G L L + A+ LH + +H DIK +N+ Sbjct: 34 MVMEYVEGGDCASLLKNIGALPADLARMYFAETVLAVEYLHSYGIVHRDIKPDNL 88 >SB_28695| Best HMM Match : Ras (HMM E-Value=0) Length = 1058 Score = 32.3 bits (70), Expect = 0.065 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 I M+++ + + L+ G + RQ+ + ++ LH +N IH DIK N+ Sbjct: 256 IFMEFVPGGSIAQALKRFGAFVEPVFRRYTRQILDGVSYLHNNNVIHRDIKGGNI 310 >SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 622 Score = 31.9 bits (69), Expect = 0.085 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -2 Query: 162 MDYID-CPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 MD D C ++ + S + S+ +RQ+ EA++ H++ IH D+K NV Sbjct: 1 MDGADLCFEIVNRVNAGFVYSEAVASHYMRQVLEAVSFCHENGIIHRDLKPHNV 54 >SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) Length = 228 Score = 31.9 bits (69), Expect = 0.085 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = -2 Query: 132 ETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 + L+ KG L + V + Q+ + L+ LH N IH D+K N+ Sbjct: 18 QLLRDKGPLVEETVRQYVWQILKGLSFLHGVNIIHRDLKGANI 60 >SB_5779| Best HMM Match : Pkinase (HMM E-Value=1.8e-19) Length = 284 Score = 31.9 bits (69), Expect = 0.085 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = -2 Query: 141 DLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 +LFE ++ K + + +++ +AL H N H D+K EN+ Sbjct: 5 ELFEQIRKKRRFTEKEAMKFTKEIAQALYHCHSFNVAHRDLKPENL 50 >SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 1258 Score = 31.5 bits (68), Expect = 0.11 Identities = 21/68 (30%), Positives = 35/68 (51%) Frame = -2 Query: 207 KIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIH 28 K+Y ++ I + +L E + G +H+ V N I QL +A+ H+++ IH Sbjct: 91 KLYLVFEYVEKVCITYVKKNMLELLEEMP-NGVPAHR-VRNYIFQLIKAIKWCHQNDVIH 148 Query: 27 NDIKLENV 4 DIK EN+ Sbjct: 149 RDIKPENL 156 >SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 31.5 bits (68), Expect = 0.11 Identities = 16/54 (29%), Positives = 29/54 (53%) Frame = -2 Query: 165 VMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 VM+Y++ DL +Q +G+ + ++ L LH+ I+ D+KL+NV Sbjct: 364 VMEYLNGGDLMFHIQNQGKFDEKRSRFYAAEIVCGLQFLHELGIIYRDLKLDNV 417 >SB_19466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 31.5 bits (68), Expect = 0.11 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -2 Query: 123 QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 + KG L L + +A+ +H + FIHNDIK NV Sbjct: 10 EYKGPLPEDLYIPFTTDILKAVEFMHGNGFIHNDIKGANV 49 >SB_56812| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.3e-06) Length = 208 Score = 31.1 bits (67), Expect = 0.15 Identities = 18/55 (32%), Positives = 31/55 (56%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 IVM+ + C DL LQ +G LS + + + + L +HK +++ D+K +NV Sbjct: 29 IVMERVRC-DLLTALQ-EG-LSWEQRLTVAKDVARGLQKIHKAEYVYRDLKPQNV 80 >SB_26356| Best HMM Match : Pkinase (HMM E-Value=0.00044) Length = 634 Score = 31.1 bits (67), Expect = 0.15 Identities = 18/55 (32%), Positives = 31/55 (56%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 IVM+ + C DL LQ +G LS + + + + L +HK +++ D+K +NV Sbjct: 527 IVMERVRC-DLLTALQ-EG-LSWEQRLTVAKDVARGLQKIHKAEYVYRDLKPQNV 578 >SB_38378| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 478 Score = 31.1 bits (67), Expect = 0.15 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 Query: 93 VSNIIRQLCEALNDLHKHNFIHNDIKLEN 7 ++ ++RQ+ A+ L HNFIH D+ N Sbjct: 309 MTEMVRQVAAAMKYLESHNFIHRDLAARN 337 >SB_3002| Best HMM Match : Pkinase (HMM E-Value=4.1e-17) Length = 683 Score = 31.1 bits (67), Expect = 0.15 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -2 Query: 84 IIRQLCEALNDLHKHNFIHNDIKLENV 4 I+ + EA++ +H HN +H D+K EN+ Sbjct: 600 IMLSIFEAVDYMHYHNVVHRDLKPENI 626 >SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1378 Score = 30.7 bits (66), Expect = 0.20 Identities = 15/55 (27%), Positives = 30/55 (54%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 +VM+Y+ L + + + + ++ + R+ +AL LH + IH DIK +N+ Sbjct: 294 VVMEYLAGGSLTDVVT-ETCMDEGQIAAVCRECLQALEFLHSNGVIHRDIKSDNI 347 >SB_31696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 30.7 bits (66), Expect = 0.20 Identities = 14/50 (28%), Positives = 29/50 (58%) Frame = -2 Query: 153 IDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 +D D+ + + K +++ + + +IR + AL LH+ N +H DI+ N+ Sbjct: 126 LDGEDVLKFMSSKTKVTEEDAALVIRGILNALCYLHELNIVHLDIRPANI 175 >SB_1621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 727 Score = 30.7 bits (66), Expect = 0.20 Identities = 17/71 (23%), Positives = 32/71 (45%) Frame = -2 Query: 216 FFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHN 37 F +++Y N +VM+ L + + KG + + + +I + E + LH Sbjct: 126 FVVRLYEVFECKNRVYLVMELATGGVLLDRILSKGFFTERDATRVIYMVLEGVRYLHSLG 185 Query: 36 FIHNDIKLENV 4 H D+K EN+ Sbjct: 186 ITHRDLKPENL 196 >SB_26967| Best HMM Match : Pkinase (HMM E-Value=0) Length = 428 Score = 30.7 bits (66), Expect = 0.20 Identities = 15/71 (21%), Positives = 32/71 (45%) Frame = -2 Query: 216 FFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHN 37 F + Y + G + ++ + C +T K +L + +Q+ ++ H+H Sbjct: 94 FMVMEYVSGGELFEYILKHGKVQCD---KTSHFKVQLEEKDARRFFQQIISGVDYCHRHM 150 Query: 36 FIHNDIKLENV 4 +H D+K EN+ Sbjct: 151 VVHRDLKPENL 161 >SB_1165| Best HMM Match : Pkinase (HMM E-Value=5.6e-23) Length = 560 Score = 30.7 bits (66), Expect = 0.20 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = -2 Query: 171 VIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 +I M+Y+D + L G V +++ + EAL LH +H D+K NV Sbjct: 414 IIFMEYMDGGSVEMFLSNNGSADEDSVKCVMQVILEALCWLHSKGVVHLDLKGGNV 469 >SB_46497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.9 bits (64), Expect = 0.34 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -2 Query: 123 QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLE 10 + KG L L + +A+ +H + FIHNDIK E Sbjct: 10 EYKGPLPEDLYIPFTTDILKAVEFMHGNGFIHNDIKGE 47 >SB_58677| Best HMM Match : Pkinase (HMM E-Value=2.8e-33) Length = 834 Score = 29.5 bits (63), Expect = 0.46 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = -2 Query: 171 VIVMDYI--DCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLEN 7 V+VMD + DLF K + L+ + Q+ + +H NFIH DIK +N Sbjct: 84 VLVMDLLGPSLEDLFNFCNRKFNMKTVLM--LADQMIARIEYVHNKNFIHRDIKPDN 138 >SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) Length = 801 Score = 29.5 bits (63), Expect = 0.46 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 75 QLCEALNDLHKHNFIHNDIKLENV 4 Q+C A++ +H IH DIK +NV Sbjct: 647 QVCMAVDHIHTSGIIHKDIKAKNV 670 >SB_25790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 29.5 bits (63), Expect = 0.46 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 138 LFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 16 + E ++ G L+ L RQ+ E + LH + +H DIK Sbjct: 3 IHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIK 43 >SB_13192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 29.5 bits (63), Expect = 0.46 Identities = 13/55 (23%), Positives = 30/55 (54%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 ++++Y +LF L+ G ++ ++ A++ LH H+ ++ D+K EN+ Sbjct: 116 MLLEYACGGELFTYLRTAGRFNNGTGLFFGSEIVSAMDYLHGHSIVYRDLKPENI 170 >SB_34303| Best HMM Match : Pkinase (HMM E-Value=0) Length = 226 Score = 29.1 bits (62), Expect = 0.60 Identities = 15/57 (26%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGE--LSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 +V +++D DL L+ + L + ++ Q+ ++ LH H +H DIK +N+ Sbjct: 89 LVFEHVD-QDLAAYLEYCPQPGLGEWKIKDLTYQILNGVDFLHTHRIVHRDIKPQNI 144 >SB_19291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 29.1 bits (62), Expect = 0.60 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = -2 Query: 138 LFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENVF 1 L + L+ +S + V N + L L LH +H DIK NVF Sbjct: 562 LKDYLEKNDSVSEREVWNFLLDLTLGLKHLHDSGMVHMDIKPANVF 607 >SB_51259| Best HMM Match : Pkinase_Tyr (HMM E-Value=3.4e-08) Length = 181 Score = 29.1 bits (62), Expect = 0.60 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 84 IIRQLCEALNDLHKHNFIHNDIKLENV 4 I+ + AL LH + IH D+KL+NV Sbjct: 21 ILLDVARALKYLHSLDLIHRDVKLQNV 47 >SB_41851| Best HMM Match : Pkinase (HMM E-Value=0) Length = 967 Score = 28.7 bits (61), Expect = 0.80 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = -2 Query: 114 GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 G ++ +RQ+ + ++ LH++ +H DIK N+ Sbjct: 710 GPFEEAILIRYLRQILQGVSYLHENQVVHRDIKGANI 746 >SB_36782| Best HMM Match : Pkinase (HMM E-Value=1.4e-32) Length = 310 Score = 28.7 bits (61), Expect = 0.80 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = -2 Query: 93 VSNIIRQLCEALNDLHKHNFIHNDIKLENVF 1 ++ I Q+ + + LH +H D++ +NVF Sbjct: 113 IAQITTQIAQGMGYLHARGIVHTDLRSKNVF 143 >SB_3250| Best HMM Match : Pkinase (HMM E-Value=1e-09) Length = 166 Score = 28.7 bits (61), Expect = 0.80 Identities = 15/55 (27%), Positives = 27/55 (49%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 IVM+ + +L + + LS + NI+ L + LH+ +H D+K N+ Sbjct: 24 IVMELMRGGELLDRILKHKCLSEREAGNIMYTLTSTIAFLHEEGVVHRDLKPSNI 78 >SB_58868| Best HMM Match : Pkinase (HMM E-Value=1.9e-32) Length = 434 Score = 28.7 bits (61), Expect = 0.80 Identities = 15/55 (27%), Positives = 27/55 (49%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 IVM+ + +L + + LS + NI+ L + LH+ +H D+K N+ Sbjct: 291 IVMELMRGGELLDRILKHKCLSEREAGNIMYTLTSTIAFLHEEGVVHRDLKPSNI 345 >SB_11275| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.0005) Length = 256 Score = 28.7 bits (61), Expect = 0.80 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -2 Query: 87 NIIRQLCEALNDLHKHNFIHNDIKLENV 4 +I + +AL+ +H F+HND+K NV Sbjct: 182 SIFAGVADALHFIHGRGFVHNDLKGNNV 209 >SB_51685| Best HMM Match : Pkinase (HMM E-Value=0) Length = 380 Score = 28.3 bits (60), Expect = 1.1 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 105 SHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 S + ++ QL E LH+H +H D+K+ N+ Sbjct: 133 SEAQIKCLMIQLLEGTKYLHEHFIVHRDLKVSNL 166 >SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) Length = 783 Score = 27.9 bits (59), Expect = 1.4 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = -2 Query: 141 DLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 16 +LFE + + L+ + + + QL + + +HK N +H D+K Sbjct: 143 ELFERVVDEDCLTEKEAAYYMHQLLQGIEHVHKKNVLHLDLK 184 >SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1351 Score = 27.9 bits (59), Expect = 1.4 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = -2 Query: 108 LSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 +S L+ + + QL + H H +H D+K +N+ Sbjct: 65 ISTSLIKSYVYQLLSGVAYCHSHRVLHRDLKPQNL 99 >SB_13922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1012 Score = 27.9 bits (59), Expect = 1.4 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -2 Query: 87 NIIRQLCEALNDLHKHNFIHNDIKLENVF 1 N+ Q+ A+ H +H D+K N+F Sbjct: 769 NVFEQIVNAVEYFHNRGMMHRDLKPSNIF 797 >SB_2079| Best HMM Match : Pkinase (HMM E-Value=4.2e-10) Length = 210 Score = 27.9 bits (59), Expect = 1.4 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -2 Query: 75 QLCEALNDLHKHNFIHNDIKLENVF 1 QL AL +H +H DIK NVF Sbjct: 121 QLTAALEHMHSRRVMHRDIKPANVF 145 >SB_38918| Best HMM Match : DUF997 (HMM E-Value=2.3) Length = 860 Score = 27.5 bits (58), Expect = 1.8 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -2 Query: 138 LFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLEN 7 LF LQI L +L N+ R + A+ D ++ ND+ +N Sbjct: 215 LFCVLQIAHHLQWRLTKNLYRDISTAIEDFNRLCEYSNDVLQDN 258 >SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) Length = 603 Score = 27.5 bits (58), Expect = 1.8 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 84 IIRQLCEALNDLHKHNFIHNDIKLENV 4 +++Q L LH N +H DIK NV Sbjct: 292 VLQQATSGLAHLHSLNIVHRDIKPHNV 318 >SB_10682| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) Length = 165 Score = 27.5 bits (58), Expect = 1.8 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKL 13 +V +Y+D DL ++ L I+ QL +A +H N IH D+K+ Sbjct: 47 LVFEYMDT-DLHNVIKRGNILKDIHKRYIMYQLLKATKFIHSGNVIHRDLKI 97 >SB_11865| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.7e-07) Length = 184 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 72 LCEALNDLHKHNFIHNDIKLENVF 1 LC AL +H+ H D+K N+F Sbjct: 152 LCSALEFIHEREIAHLDVKPANIF 175 >SB_10367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 481 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 81 IRQLCEALNDLHKHNFIHNDIKLENV 4 ++ + E L H+ F+HND+K NV Sbjct: 343 LKTIAETLLFCHQKGFLHNDLKQNNV 368 >SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2229 Score = 27.5 bits (58), Expect = 1.8 Identities = 15/55 (27%), Positives = 29/55 (52%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 +V++ + +L E+L + ++ I Q+ +AL LH I+ D+K EN+ Sbjct: 1591 LVLELAEKGNLSESLSSPIPIHRIVLFRIAYQIADALAYLHTLGVIYRDLKPENI 1645 >SB_53183| Best HMM Match : Ras (HMM E-Value=0) Length = 834 Score = 27.1 bits (57), Expect = 2.4 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = -2 Query: 117 KGELSHQLVSNIIRQLCEALNDLHKHNFIH 28 +G ++H+++ + I QL A++ L NF+H Sbjct: 804 RGLINHEMLLDYIFQLSTAMSYLESKNFVH 833 >SB_40595| Best HMM Match : Pkinase (HMM E-Value=3.4e-08) Length = 335 Score = 27.1 bits (57), Expect = 2.4 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = -2 Query: 171 VIVMDYI--DCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLEN 7 V+VM+ + DLF K + L+ + Q + +H NFIH DIK +N Sbjct: 42 VLVMELLGPSLEDLFNFCNRKFSIKTVLL--LADQTISRIEYVHSKNFIHRDIKPDN 96 >SB_16221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 834 Score = 27.1 bits (57), Expect = 2.4 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 Query: 78 RQLCEALNDLHKHNFIHNDIKLENV 4 RQ+ A++ HK + +H D+K ENV Sbjct: 22 RQIVLAIDYCHKLHVVHRDLKPENV 46 >SB_27678| Best HMM Match : Pkinase (HMM E-Value=0) Length = 641 Score = 26.6 bits (56), Expect = 3.2 Identities = 13/43 (30%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -2 Query: 123 QIKGELSHQLVSNIIRQLCEALNDLHKHN--FIHNDIKLENVF 1 + KG + +++ + RQ+ + L+ LH IH D+K +N+F Sbjct: 175 RFKG-VKEKILKSWCRQILKGLHFLHTRTPPIIHRDLKCDNIF 216 >SB_19615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1376 Score = 26.6 bits (56), Expect = 3.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 75 QLCEALNDLHKHNFIHNDIKLENV 4 QL AL+ LH +H D+ EN+ Sbjct: 1189 QLFAALDHLHSEGIVHRDLNAENL 1212 >SB_57461| Best HMM Match : Pkinase (HMM E-Value=1.1e-34) Length = 355 Score = 26.6 bits (56), Expect = 3.2 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 75 QLCEALNDLHKHNFIHNDIKLEN 7 Q+ + +H NFIH DIK +N Sbjct: 121 QMISRIEYVHNKNFIHRDIKPDN 143 >SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 819 Score = 26.2 bits (55), Expect = 4.2 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 63 ALNDLHKHNFIHNDIKLENV 4 AL LH N +H D+K ENV Sbjct: 599 ALKYLHSKNIVHCDLKPENV 618 >SB_14271| Best HMM Match : Pkinase (HMM E-Value=2.1e-27) Length = 2056 Score = 26.2 bits (55), Expect = 4.2 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -2 Query: 84 IIRQLCEALNDLHKHNFIHNDIKLENV 4 +I++ + L+ LH +H+DIK N+ Sbjct: 311 VIKEAAKGLSYLHNKGIVHSDIKTCNI 337 >SB_53368| Best HMM Match : CLN3 (HMM E-Value=1.4e-07) Length = 419 Score = 26.2 bits (55), Expect = 4.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 192 HGFINNQVIVMDYIDCPDLFETLQIKG 112 HGFI+ ++V ++ DLFE KG Sbjct: 336 HGFISGSIMVNGALEAADLFEDSVDKG 362 >SB_4877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 517 Score = 26.2 bits (55), Expect = 4.2 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -2 Query: 84 IIRQLCEALNDLHKHNFIHNDIKLENV 4 +I++ + L+ LH +H+DIK N+ Sbjct: 292 VIKEAAKGLSYLHNKGIVHSDIKTCNI 318 >SB_51803| Best HMM Match : Ion_trans_2 (HMM E-Value=2.3e-30) Length = 823 Score = 25.8 bits (54), Expect = 5.6 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = -2 Query: 105 SHQLVSNIIRQLCEALNDLHKHNFIHND 22 S +++ ++++CE HK + HND Sbjct: 251 SMEVIRAFVQEMCEIFERTHKCKYSHND 278 >SB_27024| Best HMM Match : Pkinase (HMM E-Value=4.7e-25) Length = 1595 Score = 25.8 bits (54), Expect = 5.6 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -2 Query: 135 FETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 +ET Q L L I Q+ AL LH + I+ D+K +NV Sbjct: 487 YETKQTP--LGRGLTYKIAYQVASALWYLHDSDIIYRDLKTDNV 528 >SB_12792| Best HMM Match : Pkinase (HMM E-Value=1.1e-09) Length = 196 Score = 25.8 bits (54), Expect = 5.6 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = -2 Query: 117 KGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIKLEN 7 +G LS ++ Q+ A+N +H+ +H+D+K N Sbjct: 29 RGCLSSTHLAVYWEQMLRAVNVIHERGIVHSDLKPAN 65 >SB_6123| Best HMM Match : MutS_III (HMM E-Value=1.8e-09) Length = 730 Score = 25.8 bits (54), Expect = 5.6 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -2 Query: 210 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQL 94 +++++N +N +V CPD+ TLQ +GEL L Sbjct: 267 VEMFYNDRHLNEEVRQC-LKRCPDIERTLQKEGELDRLL 304 >SB_13067| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 25.8 bits (54), Expect = 5.6 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 96 LVSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 ++ N R L +AL+ L IH DIK N+ Sbjct: 25 VIQNCCRDLGQALDCLRTLGIIHGDIKPTNI 55 >SB_8123| Best HMM Match : Tfb2 (HMM E-Value=0.00019) Length = 448 Score = 25.8 bits (54), Expect = 5.6 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -3 Query: 131 KRYKLKASFRTNLLAIL 81 KRY++ A+FRTN+ A L Sbjct: 73 KRYEMNATFRTNMKAAL 89 >SB_6592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1228 Score = 25.8 bits (54), Expect = 5.6 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 75 QLCEALNDLHKHNFIHNDIKLENV 4 Q+ EA+ LH+ IH D+ N+ Sbjct: 969 QIAEAMEALHRDKCIHRDLAARNI 992 >SB_56328| Best HMM Match : NHL (HMM E-Value=0.082) Length = 454 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 81 IRQLCEALNDLHKHNFIHNDIKLENVF 1 IRQ E L DL +NF + + EN+F Sbjct: 285 IRQEGEPLIDLRNNNFYYITVTQENIF 311 >SB_43494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 25.4 bits (53), Expect = 7.4 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 84 IIRQLCEALNDLHKHNFIHNDIKLENV 4 I++Q+ AL+ L IH D+K EN+ Sbjct: 203 IVQQVLVALSKLRTLGLIHADLKPENI 229 >SB_30262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 453 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = -2 Query: 168 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 43 ++MDY++ +LF L + + + V I ++ AL+ LH+ Sbjct: 114 LIMDYVNGGELFTHLYQREKFTEDEVRLYIGEIVVALDHLHQ 155 >SB_28310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1051 Score = 25.4 bits (53), Expect = 7.4 Identities = 12/43 (27%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = -2 Query: 153 IDCPDLFETLQIKGELSHQLVSNIIR-QLCEALNDLHKHNFIH 28 + C ++L+IK ++ V +++ Q C+ LN +H+ N +H Sbjct: 247 LTCKHKDKSLKIKCYIAKNKVFSVLSGQACKDLNLIHRINHVH 289 >SB_8812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 604 Score = 25.4 bits (53), Expect = 7.4 Identities = 16/62 (25%), Positives = 26/62 (41%), Gaps = 4/62 (6%) Frame = -2 Query: 210 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE----LSHQLVSNIIRQLCEALNDLHK 43 I++Y + +VM+Y DL + + + + L N RQL E + HK Sbjct: 114 IQLYETFHTCHKIFLVMEYAAKGDLLDYINSRCRRCVGIGEDLAKNFFRQLTEGIMHCHK 173 Query: 42 HN 37 N Sbjct: 174 RN 175 >SB_46446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 323 Score = 25.4 bits (53), Expect = 7.4 Identities = 11/44 (25%), Positives = 24/44 (54%) Frame = -2 Query: 147 CPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 16 C D+ G + L++ I++++ + L+ LH+ + IH +K Sbjct: 56 CADILSESYRDG-MPEALIAAILKEVLQGLDYLHRMSIIHRGMK 98 >SB_40655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1074 Score = 25.4 bits (53), Expect = 7.4 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -2 Query: 63 ALNDLHKHNFIHNDIKLENV 4 AL+ +H +N +H D+K EN+ Sbjct: 460 ALDYMHGNNIVHLDLKPENI 479 >SB_25595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 25.4 bits (53), Expect = 7.4 Identities = 13/45 (28%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -2 Query: 171 VIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEAL-NDLHKH 40 V+ + Y+ D ++ + VS IIR+ C A+ LHK+ Sbjct: 12 VVTLRYLATGDSQQSQSFNFRIGRSTVSEIIRETCSAIWEALHKN 56 >SB_25445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 25.4 bits (53), Expect = 7.4 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -2 Query: 78 RQLCEALNDLHKHNFIHNDIKLENV 4 RQ+ A+ +H+ + H D+K EN+ Sbjct: 158 RQIISAVAYIHEKGYAHRDLKPENL 182 >SB_52903| Best HMM Match : DUF1126 (HMM E-Value=0) Length = 1452 Score = 25.0 bits (52), Expect = 9.8 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 Query: 93 VSNIIRQLCEALNDLHKHNFIHNDIKLENV 4 V +I QL A+ LH+ H D+K EN+ Sbjct: 812 VRHISYQLIVAVKFLHEMKLTHTDLKPENM 841 >SB_48964| Best HMM Match : TRAP_240kDa (HMM E-Value=0) Length = 1227 Score = 25.0 bits (52), Expect = 9.8 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = -2 Query: 183 INNQVIVMDYIDCPDLFETLQIKG 112 +N+ ++V Y+DC ++ + L IKG Sbjct: 188 VNDPLLVEGYVDCYNVDDPLLIKG 211 >SB_21129| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) Length = 786 Score = 25.0 bits (52), Expect = 9.8 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 75 QLCEALNDLHKHNFIHNDIKLENV 4 Q+ + + LH H IH D+ L N+ Sbjct: 3 QVVKGVLYLHSHGIIHRDLSLGNI 26 >SB_20165| Best HMM Match : Pkinase (HMM E-Value=0.00013) Length = 150 Score = 25.0 bits (52), Expect = 9.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 72 LCEALNDLHKHNFIHNDIKLENV 4 + E L LHKH ++ D+K N+ Sbjct: 1 VAEGLAYLHKHMIVYRDLKPHNI 23 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,328,026 Number of Sequences: 59808 Number of extensions: 51301 Number of successful extensions: 315 Number of sequences better than 10.0: 116 Number of HSP's better than 10.0 without gapping: 307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 315 length of database: 16,821,457 effective HSP length: 50 effective length of database: 13,831,057 effective search space used: 304283254 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -