BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10j18 (669 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_269| Best HMM Match : ubiquitin (HMM E-Value=1.2e-09) 34 0.12 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_41563| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_269| Best HMM Match : ubiquitin (HMM E-Value=1.2e-09) Length = 414 Score = 33.9 bits (74), Expect = 0.12 Identities = 28/101 (27%), Positives = 51/101 (50%) Frame = +2 Query: 350 ISELKRHVARKLHIPVEQQKXXXXXXXXXDDHTIQMYPNIKEGTKLNLVVKKPESLYDAS 529 I +K VA++L + VE+Q+ DD ++ Y I +G+KL L +KK S +S Sbjct: 126 ILAVKTLVAQELDVQVERQRLVYKGKTLADDCSLDEYL-IGDGSKLYLSIKKLSSQPGSS 184 Query: 530 FKHYKRQGMSDKDAANTANKLLRIVQEKFDKMSWDEVDRLC 652 K+Y +N N+L ++++ ++ D+V + C Sbjct: 185 QKNYA--------GSNFWNQLHKLLKSHLNEKDADKVLQRC 217 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/39 (30%), Positives = 26/39 (66%) Frame = -2 Query: 239 NLVFLTPKTARDEAQVHHDLNNDL*FKNQFKG*MNLSSC 123 +L++LT +T+ D Q+ +DLN + N+++ +N++ C Sbjct: 402 SLLYLTIETSDDVIQLQNDLNKLYEWSNKWQMELNINKC 440 >SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 689 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/39 (30%), Positives = 26/39 (66%) Frame = -2 Query: 239 NLVFLTPKTARDEAQVHHDLNNDL*FKNQFKG*MNLSSC 123 +L++LT +T+ D Q+ +DLN + N+++ +N++ C Sbjct: 470 SLLYLTIETSDDVIQLQNDLNKLYEWSNKWQMELNINKC 508 >SB_41563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/39 (30%), Positives = 25/39 (64%) Frame = -2 Query: 239 NLVFLTPKTARDEAQVHHDLNNDL*FKNQFKG*MNLSSC 123 +L++LT +T+ D Q+ +DLN + N+++ +N+ C Sbjct: 16 SLLYLTIETSDDVIQLQNDLNKLYEWSNKWQMELNIDKC 54 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,162,578 Number of Sequences: 59808 Number of extensions: 345775 Number of successful extensions: 653 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -