BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10j16 (791 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 26 1.5 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 26 1.5 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 25 3.5 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 24 6.2 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 25.8 bits (54), Expect = 1.5 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +3 Query: 423 VVYEMKLFQAMYFSNVLLNYVVFSDNQMGT-NFVFVNNL 536 V+Y +F F NVL+ YVVF + M T +F+ NL Sbjct: 100 VLYS-SIFVLGVFGNVLVCYVVFRNKAMQTVTNLFITNL 137 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 25.8 bits (54), Expect = 1.5 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -2 Query: 394 VHKVGAFSATDIKNDNRNQYCKYSNSLNVAMYPTN 290 +HK G S ++ D +Y ++AMYP N Sbjct: 295 LHKAGGRSCMHVEFDIEGSKMRYEAGDHLAMYPVN 329 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 24.6 bits (51), Expect = 3.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 589 ATQWARTRIIDMPNHVI 639 A W R R++D NH+I Sbjct: 189 AVPWVRDRVVDFLNHLI 205 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 23.8 bits (49), Expect = 6.2 Identities = 14/52 (26%), Positives = 20/52 (38%) Frame = +3 Query: 390 WTAFKTTEAHEVVYEMKLFQAMYFSNVLLNYVVFSDNQMGTNFVFVNNLIHC 545 WT HEVV+ YF+ +LL + + VF+ HC Sbjct: 580 WTVLTCNVPHEVVFRASRSNNFYFA-LLLTMLFLCVLPVSYAIVFLEPSWHC 630 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 829,244 Number of Sequences: 2352 Number of extensions: 17793 Number of successful extensions: 19 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83160600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -