BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10j16 (791 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57940.3 68418.m07250 cyclic nucleotide-regulated ion channel... 29 4.7 At5g57940.2 68418.m07249 cyclic nucleotide-regulated ion channel... 29 4.7 At5g57940.1 68418.m07248 cyclic nucleotide-regulated ion channel... 29 4.7 At2g30575.1 68415.m03725 glycosyl transferase family 8 protein c... 29 4.7 >At5g57940.3 68418.m07250 cyclic nucleotide-regulated ion channel / cyclic nucleotide-gated channel (CNGC5) identical to cyclic nucleotide and calmodulin-regulated ion channel (cngc5) GI:4581205 from [Arabidopsis thaliana] Length = 710 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +3 Query: 327 YLQYWFLLSFLMSVALNAPTLWTAFKTTEAHEVVYEMKLFQAMYFSNVLLNYV 485 YLQ WF++ FL + L +W +++ +V + QA+ F VL+ Y+ Sbjct: 180 YLQRWFIIDFLSVLPLPQIVVWRFLQSSNGSDV---LATKQALLFI-VLVQYI 228 >At5g57940.2 68418.m07249 cyclic nucleotide-regulated ion channel / cyclic nucleotide-gated channel (CNGC5) identical to cyclic nucleotide and calmodulin-regulated ion channel (cngc5) GI:4581205 from [Arabidopsis thaliana] Length = 717 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +3 Query: 327 YLQYWFLLSFLMSVALNAPTLWTAFKTTEAHEVVYEMKLFQAMYFSNVLLNYV 485 YLQ WF++ FL + L +W +++ +V + QA+ F VL+ Y+ Sbjct: 187 YLQRWFIIDFLSVLPLPQIVVWRFLQSSNGSDV---LATKQALLFI-VLVQYI 235 >At5g57940.1 68418.m07248 cyclic nucleotide-regulated ion channel / cyclic nucleotide-gated channel (CNGC5) identical to cyclic nucleotide and calmodulin-regulated ion channel (cngc5) GI:4581205 from [Arabidopsis thaliana] Length = 717 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +3 Query: 327 YLQYWFLLSFLMSVALNAPTLWTAFKTTEAHEVVYEMKLFQAMYFSNVLLNYV 485 YLQ WF++ FL + L +W +++ +V + QA+ F VL+ Y+ Sbjct: 187 YLQRWFIIDFLSVLPLPQIVVWRFLQSSNGSDV---LATKQALLFI-VLVQYI 235 >At2g30575.1 68415.m03725 glycosyl transferase family 8 protein contains Pfam profile: PF01501 glycosyl transferase family 8 Length = 610 Score = 28.7 bits (61), Expect = 4.7 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +3 Query: 405 TTEAHEVVYEMK-LFQAMYFSNVLLNYVVFSDNQMGTNFVFVNNLI 539 TTE + +E + L Q Y L +YVVFSDN + ++ V VN+ I Sbjct: 297 TTEYFTLDHEKRQLLQQSYNDPDLYHYVVFSDNVLASS-VVVNSTI 341 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,121,016 Number of Sequences: 28952 Number of extensions: 321792 Number of successful extensions: 653 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1785055200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -