BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10j13 (426 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein ... 203 2e-54 AY341235-1|AAR13799.1| 196|Anopheles gambiae transferrin-like p... 26 0.64 AY341234-1|AAR13798.1| 196|Anopheles gambiae transferrin-like p... 26 0.64 AY341233-1|AAR13797.1| 196|Anopheles gambiae transferrin-like p... 26 0.64 AY341232-1|AAR13796.1| 196|Anopheles gambiae transferrin-like p... 26 0.64 AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein p... 25 0.85 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 23 6.0 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 6.0 U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. 22 7.9 >AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein S26 protein. Length = 114 Score = 203 bits (496), Expect = 2e-54 Identities = 93/111 (83%), Positives = 101/111 (90%) Frame = +2 Query: 53 KRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYPMFQ 232 +RRNGGR KH RGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDI+DASVY + Sbjct: 3 ERRNGGRCKHNRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISDASVYSSYV 62 Query: 233 LPKLYAKLHYCVSCAIHSKVVRNRSKKDRRIRTPPKSNFPRDMSRPQAVQR 385 LPKLYAKLHYCVSCAIHSKVVRNRSK+ RRIRTPP+ +FP+DM+R Q QR Sbjct: 63 LPKLYAKLHYCVSCAIHSKVVRNRSKETRRIRTPPQRSFPKDMNRQQNAQR 113 >AY341235-1|AAR13799.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 25.8 bits (54), Expect = 0.64 Identities = 11/44 (25%), Positives = 19/44 (43%) Frame = +2 Query: 77 KHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDIND 208 K G+GH + + N C P+ I N+ + + D N+ Sbjct: 50 KEGKGHDRFEKLRNAKACFPEFGGIASIAFVNVGRSRGIFDRNE 93 >AY341234-1|AAR13798.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 25.8 bits (54), Expect = 0.64 Identities = 11/44 (25%), Positives = 19/44 (43%) Frame = +2 Query: 77 KHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDIND 208 K G+GH + + N C P+ I N+ + + D N+ Sbjct: 50 KEGKGHDRFEKLRNAKACFPEFGGIASIAFVNVGRSRGIFDRNE 93 >AY341233-1|AAR13797.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 25.8 bits (54), Expect = 0.64 Identities = 11/44 (25%), Positives = 19/44 (43%) Frame = +2 Query: 77 KHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDIND 208 K G+GH + + N C P+ I N+ + + D N+ Sbjct: 50 KEGKGHDRFEKLRNAKACFPEFGGIASIAFVNVGRSRGIFDRNE 93 >AY341232-1|AAR13796.1| 196|Anopheles gambiae transferrin-like protein. Length = 196 Score = 25.8 bits (54), Expect = 0.64 Identities = 11/44 (25%), Positives = 19/44 (43%) Frame = +2 Query: 77 KHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDIND 208 K G+GH + + N C P+ I N+ + + D N+ Sbjct: 50 KEGKGHDRFEKLRNAKACFPEFGGIASIAFVNVGRSRGIFDRNE 93 >AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein protein. Length = 298 Score = 25.4 bits (53), Expect = 0.85 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +2 Query: 11 RSLFTGSEVRNMTRKRRNGGRAKHGRGHVKAVRCTNCARCV 133 R L G VR R+ + G + KAV CTN +C+ Sbjct: 238 RCLERGHMVRECQGTNRSSLCIRCGAANHKAVNCTNDVKCL 278 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 22.6 bits (46), Expect = 6.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 283 QQSCQEQIEERQKNPYSSQ 339 QQ Q+Q ++RQ+ P S Q Sbjct: 254 QQLSQQQQQQRQRQPSSQQ 272 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 22.6 bits (46), Expect = 6.0 Identities = 16/75 (21%), Positives = 32/75 (42%) Frame = +2 Query: 119 CARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYPMFQLPKLYAKLHYCVSCAIHSKVVR 298 CA V K + + ++ IR + + DI ASV+ + Y + + + Sbjct: 808 CATTVRKGRKLYQYTIRLPINSPWKEDILIASVFNECRPDAETVAYLYHIRMELICPIPE 867 Query: 299 NRSKKDRRIRTPPKS 343 ++ + R+I P +S Sbjct: 868 EQNTRGRKIYAPEES 882 >U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. Length = 278 Score = 22.2 bits (45), Expect = 7.9 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 315 TEESVLLPRVTSLGTCHVHRQ 377 T+ S+ PR+T T HV+ + Sbjct: 176 TDGSIFPPRITKNSTLHVYEK 196 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 407,072 Number of Sequences: 2352 Number of extensions: 8032 Number of successful extensions: 23 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 34867302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -