BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10j12 (346 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-tran... 24 1.8 EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhy... 23 2.4 AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long fo... 23 3.2 AY846632-1|AAW31598.1| 412|Anopheles gambiae SAGLIN protein. 23 4.2 AY341201-1|AAR13765.1| 154|Anopheles gambiae NOS protein. 22 5.6 AY341200-1|AAR13764.1| 154|Anopheles gambiae NOS protein. 22 5.6 AY341199-1|AAR13763.1| 154|Anopheles gambiae NOS protein. 22 5.6 AY341198-1|AAR13762.1| 154|Anopheles gambiae NOS protein. 22 5.6 AY341197-1|AAR13761.1| 154|Anopheles gambiae NOS protein. 22 5.6 AY341196-1|AAR13760.1| 154|Anopheles gambiae NOS protein. 22 5.6 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 21 9.7 >AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-transferase u2 protein. Length = 222 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +1 Query: 28 YRRGLPKWPNVPKRLELLANMAH 96 YR G +PN+PK L+ + H Sbjct: 79 YRPGHTLYPNIPKEKALINRVLH 101 >EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhydrase protein. Length = 255 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -1 Query: 226 HRLQDQMPTQERFIASLPQNEQVYFAC 146 H ++QM + R + PQ + V+F C Sbjct: 13 HTTREQMVQEFRKVRDNPQPKAVFFTC 39 >AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long form protein. Length = 311 Score = 23.0 bits (47), Expect = 3.2 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = +2 Query: 47 NGQTYQKGWNYWQI 88 N +TY K W +W++ Sbjct: 47 NRETYLKTWKFWKL 60 >AY846632-1|AAW31598.1| 412|Anopheles gambiae SAGLIN protein. Length = 412 Score = 22.6 bits (46), Expect = 4.2 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -1 Query: 94 VPYLPVIPTFLVRLAILVNLSDTKVDREKK 5 VPY +P RL +L L DREKK Sbjct: 322 VPYANALPQPAQRLEVLRVLLSQIGDREKK 351 >AY341201-1|AAR13765.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 22.2 bits (45), Expect = 5.6 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = +2 Query: 47 NGQTYQKGWNYWQIWHTLRCL 109 N + + W YW++ H L L Sbjct: 90 NESSVYEDWRYWKLPHLLEVL 110 >AY341200-1|AAR13764.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 22.2 bits (45), Expect = 5.6 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = +2 Query: 47 NGQTYQKGWNYWQIWHTLRCL 109 N + + W YW++ H L L Sbjct: 90 NESSVYEDWRYWKLPHLLEVL 110 >AY341199-1|AAR13763.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 22.2 bits (45), Expect = 5.6 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = +2 Query: 47 NGQTYQKGWNYWQIWHTLRCL 109 N + + W YW++ H L L Sbjct: 90 NESSVYEDWRYWKLPHLLEVL 110 >AY341198-1|AAR13762.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 22.2 bits (45), Expect = 5.6 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = +2 Query: 47 NGQTYQKGWNYWQIWHTLRCL 109 N + + W YW++ H L L Sbjct: 90 NESSVYEDWRYWKLPHLLEVL 110 >AY341197-1|AAR13761.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 22.2 bits (45), Expect = 5.6 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = +2 Query: 47 NGQTYQKGWNYWQIWHTLRCL 109 N + + W YW++ H L L Sbjct: 90 NESSVYEDWRYWKLPHLLEVL 110 >AY341196-1|AAR13760.1| 154|Anopheles gambiae NOS protein. Length = 154 Score = 22.2 bits (45), Expect = 5.6 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = +2 Query: 47 NGQTYQKGWNYWQIWHTLRCL 109 N + + W YW++ H L L Sbjct: 90 NESSVYEDWRYWKLPHLLEVL 110 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 21.4 bits (43), Expect = 9.7 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 136 SIFLTILRREAP*RVPYLPVIPTF 65 S FL + +EAP P + IPTF Sbjct: 540 SEFLALDMKEAPTTNPRIVPIPTF 563 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 377,375 Number of Sequences: 2352 Number of extensions: 7392 Number of successful extensions: 17 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 24505155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -