BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10j06 (251 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002196-4|AAB53979.1| 198|Caenorhabditis elegans Ribosomal pro... 43 2e-05 U41033-5|AAA82377.1| 675|Caenorhabditis elegans Hypothetical pr... 31 0.11 Z81063-1|CAB02952.1| 376|Caenorhabditis elegans Hypothetical pr... 30 0.25 AF036692-8|AAB88329.1| 162|Caenorhabditis elegans Hypothetical ... 28 0.76 Z50872-8|CAA90758.1| 865|Caenorhabditis elegans Hypothetical pr... 26 3.1 AL031269-3|CAA20334.1| 865|Caenorhabditis elegans Hypothetical ... 26 3.1 AB055111-1|BAB62292.1| 865|Caenorhabditis elegans VHA-6 protein. 26 3.1 Z92829-1|CAB07339.1| 161|Caenorhabditis elegans Hypothetical pr... 26 4.1 AL021503-1|CAA16420.2| 309|Caenorhabditis elegans Hypothetical ... 26 4.1 Z81508-1|CAB04142.1| 331|Caenorhabditis elegans Hypothetical pr... 25 5.4 U41746-5|AAT81186.1| 492|Caenorhabditis elegans Innexin protein... 25 9.4 U41746-4|AAA83332.1| 559|Caenorhabditis elegans Innexin protein... 25 9.4 >AF002196-4|AAB53979.1| 198|Caenorhabditis elegans Ribosomal protein, large subunitprotein 19 protein. Length = 198 Score = 43.2 bits (97), Expect = 2e-05 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = +1 Query: 1 KGNVFKNKRVLMEYIHRKKAEKARTKMLSDQ 93 KGN FKNK+ L+EYI +KK E R K L+DQ Sbjct: 128 KGNNFKNKKNLIEYIFKKKTENKRAKQLADQ 158 >U41033-5|AAA82377.1| 675|Caenorhabditis elegans Hypothetical protein K09E3.1 protein. Length = 675 Score = 31.1 bits (67), Expect = 0.11 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +2 Query: 119 RRHASAARNVLPPRRRNCCRPSLEKTKPRLPLRSK 223 RRHAS +PP NC +P+ ++T+ + L ++ Sbjct: 14 RRHASEGGTPIPPTPANCGKPTKKRTRGHVSLATR 48 >Z81063-1|CAB02952.1| 376|Caenorhabditis elegans Hypothetical protein F15D3.2 protein. Length = 376 Score = 29.9 bits (64), Expect = 0.25 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 166 PPSWRQYVPRGACVPPL 116 P SW QY P+G C+ P+ Sbjct: 221 PNSWHQYQPKGTCIQPV 237 >AF036692-8|AAB88329.1| 162|Caenorhabditis elegans Hypothetical protein C44B12.6 protein. Length = 162 Score = 28.3 bits (60), Expect = 0.76 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 140 RNVLPPRRRNCCRPSLEKTKPRLP 211 R++L P+ R+C PS++K+ LP Sbjct: 51 RHMLTPKSRDCSEPSIDKSSEVLP 74 >Z50872-8|CAA90758.1| 865|Caenorhabditis elegans Hypothetical protein VW02B12L.1 protein. Length = 865 Score = 26.2 bits (55), Expect = 3.1 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = -3 Query: 177 LQQFLLLGGNTFLAALACLLYFIAAGLSLVAKHLRPGLLSLLPVDVLH 34 L+ L +GG AA+ L YFI + LS+ L GL + L LH Sbjct: 785 LRMSLTMGGWGGSAAITILFYFIFSILSVCILILMEGLSAFLHAIRLH 832 >AL031269-3|CAA20334.1| 865|Caenorhabditis elegans Hypothetical protein VW02B12L.1 protein. Length = 865 Score = 26.2 bits (55), Expect = 3.1 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = -3 Query: 177 LQQFLLLGGNTFLAALACLLYFIAAGLSLVAKHLRPGLLSLLPVDVLH 34 L+ L +GG AA+ L YFI + LS+ L GL + L LH Sbjct: 785 LRMSLTMGGWGGSAAITILFYFIFSILSVCILILMEGLSAFLHAIRLH 832 >AB055111-1|BAB62292.1| 865|Caenorhabditis elegans VHA-6 protein. Length = 865 Score = 26.2 bits (55), Expect = 3.1 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = -3 Query: 177 LQQFLLLGGNTFLAALACLLYFIAAGLSLVAKHLRPGLLSLLPVDVLH 34 L+ L +GG AA+ L YFI + LS+ L GL + L LH Sbjct: 785 LRMSLTMGGWGGSAAITILFYFIFSILSVCILILMEGLSAFLHAIRLH 832 >Z92829-1|CAB07339.1| 161|Caenorhabditis elegans Hypothetical protein F10A3.1 protein. Length = 161 Score = 25.8 bits (54), Expect = 4.1 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -3 Query: 159 LGGNTFLAALACLLYFIAAGLSL 91 LG + +++ A + YFIAAGL+L Sbjct: 129 LGYSAWVSVAAAVCYFIAAGLAL 151 >AL021503-1|CAA16420.2| 309|Caenorhabditis elegans Hypothetical protein Y68A4A.2 protein. Length = 309 Score = 25.8 bits (54), Expect = 4.1 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -1 Query: 95 AWSLSIFVLAFSAFFLWMYSMSTRLF 18 A+ + IFVLA FFL+ + S ++F Sbjct: 119 AFHVLIFVLAVERFFLYFFPSSEKVF 144 >Z81508-1|CAB04142.1| 331|Caenorhabditis elegans Hypothetical protein F20E11.1 protein. Length = 331 Score = 25.4 bits (53), Expect = 5.4 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -1 Query: 95 AWSLSIFVLAFSAFFLWMYSMSTRLF 18 A+ + IFVLA FF++ + S ++F Sbjct: 118 AFHVLIFVLAVERFFIYFFPSSEKIF 143 >U41746-5|AAT81186.1| 492|Caenorhabditis elegans Innexin protein 10, isoform b protein. Length = 492 Score = 24.6 bits (51), Expect = 9.4 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 92 WSLSIFVLAFSAFFLWM 42 W L++ V F +FF W+ Sbjct: 290 WYLALLVFTFGSFFYWL 306 >U41746-4|AAA83332.1| 559|Caenorhabditis elegans Innexin protein 10, isoform a protein. Length = 559 Score = 24.6 bits (51), Expect = 9.4 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 92 WSLSIFVLAFSAFFLWM 42 W L++ V F +FF W+ Sbjct: 290 WYLALLVFTFGSFFYWL 306 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,421,321 Number of Sequences: 27780 Number of extensions: 63513 Number of successful extensions: 208 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 206 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 208 length of database: 12,740,198 effective HSP length: 63 effective length of database: 10,990,058 effective search space used: 219801160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -