BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10j05 (449 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0209 - 23282848-23284110 33 0.11 10_02_0202 - 6770448-6770561,6771185-6771279,6771638-6771686,677... 29 1.3 04_03_0927 + 20871487-20871903,20872667-20872812,20873204-208733... 29 1.3 08_02_1332 + 26207164-26207257,26207454-26207530,26207771-262078... 29 1.7 02_04_0377 - 22479800-22479872,22479920-22479981,22480007-224803... 29 2.3 08_02_1563 + 27886202-27886446,27886533-27886618,27886942-278870... 27 5.3 04_04_0059 + 22418795-22418908,22419064-22419202,22419437-224195... 27 9.2 >05_05_0209 - 23282848-23284110 Length = 420 Score = 33.1 bits (72), Expect = 0.11 Identities = 24/60 (40%), Positives = 31/60 (51%), Gaps = 6/60 (10%) Frame = +1 Query: 73 FPYAALSYINVTLCTYTAMLVGY--MATFNEFEYLQYWFLLSFL---MSVALNAPTL-WT 234 FP A + V AML MAT E+LQ+WF+LS L ++VALN + WT Sbjct: 235 FPSARARAVAVAGHLNRAMLAALVSMATILAVEFLQWWFMLSLLPEAIAVALNVAIMAWT 294 >10_02_0202 - 6770448-6770561,6771185-6771279,6771638-6771686, 6771795-6771843,6772035-6772228 Length = 166 Score = 29.5 bits (63), Expect = 1.3 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +1 Query: 109 LCTYTAMLVGYMATFNEFEYLQYWFLLSFLMSVALNAPTLWTA 237 L + A+++G + YW LL L +V LN +WTA Sbjct: 50 LNAFGAIVLGAPIGIKYWAATTYWSLLMSLFTVVLNVSAIWTA 92 >04_03_0927 + 20871487-20871903,20872667-20872812,20873204-20873301, 20873378-20873572,20873670-20873797,20873892-20874050, 20875119-20875223,20875449-20875559,20875653-20875790, 20875909-20876091,20876362-20876517,20876615-20876738, 20876820-20877030,20877614-20877729,20877828-20878053, 20878218-20878311,20879198-20879275,20879822-20879971, 20880086-20880292,20880584-20880788,20880990-20881096 Length = 1117 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 330 KHHIIQQHVTKVHGLEQLHFVNYFMGFCGFERR 232 K + I QH+ ++H +L F+N F+ F G+ R Sbjct: 735 KSYDISQHLHEIHESVRLAFLNSFLDFAGYLER 767 >08_02_1332 + 26207164-26207257,26207454-26207530,26207771-26207841, 26208448-26208502,26209066-26209187,26209272-26209353, 26210070-26210160,26210759-26210982,26211294-26211413, 26211523-26211705 Length = 372 Score = 29.1 bits (62), Expect = 1.7 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -3 Query: 189 QQKPVL*IFKFVECCHVSH 133 +QKPVL + F+ CCH SH Sbjct: 97 RQKPVL--YTFINCCHTSH 113 >02_04_0377 - 22479800-22479872,22479920-22479981,22480007-22480300, 22481723-22481825,22481949-22482046 Length = 209 Score = 28.7 bits (61), Expect = 2.3 Identities = 16/61 (26%), Positives = 27/61 (44%) Frame = +1 Query: 34 TKYTRLSTDTKVKFPYAALSYINVTLCTYTAMLVGYMATFNEFEYLQYWFLLSFLMSVAL 213 T++T++ D K P + LC + + + + LQ W L FL+S+ L Sbjct: 135 TEFTQMLVDGTTKLPQSLQVRSEPILCLLEMLFFLHPVGSTKEKALQMWTLSLFLLSLVL 194 Query: 214 N 216 N Sbjct: 195 N 195 >08_02_1563 + 27886202-27886446,27886533-27886618,27886942-27887030, 27887193-27887432,27887527-27887648,27888103-27888178, 27888276-27888383,27888465-27888641,27888959-27889176, 27889313-27889445,27889584-27889807,27890052-27890205, 27890297-27890380 Length = 651 Score = 27.5 bits (58), Expect = 5.3 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -2 Query: 352 LYPFDCPKTPHNSTARY*STWLGTASFRKLLHGLL 248 LYP +CPKT N T + + F +++ G + Sbjct: 511 LYPEECPKTVENFTTHCRNGYYDNLIFHRVIKGFM 545 >04_04_0059 + 22418795-22418908,22419064-22419202,22419437-22419525, 22420428-22420690,22420793-22420883,22420966-22421325 Length = 351 Score = 26.6 bits (56), Expect = 9.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 358 QNLYPFDCPKTP 323 +N YP DCPK+P Sbjct: 207 ENTYPIDCPKSP 218 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,650,781 Number of Sequences: 37544 Number of extensions: 216389 Number of successful extensions: 447 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 447 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 871620292 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -