BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10j05 (449 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3897| Best HMM Match : DUF1662 (HMM E-Value=4.4) 32 0.25 SB_51613| Best HMM Match : DUF1662 (HMM E-Value=4.4) 29 2.3 SB_25084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_23572| Best HMM Match : 7tm_1 (HMM E-Value=6.4e-22) 28 3.1 SB_6552| Best HMM Match : Glyco_transf_9 (HMM E-Value=1.9) 28 3.1 SB_1234| Best HMM Match : RVT_1 (HMM E-Value=3.1e-08) 28 3.1 SB_57685| Best HMM Match : Pkinase_Tyr (HMM E-Value=7.9) 28 4.1 SB_19325| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_14213| Best HMM Match : RVT_1 (HMM E-Value=1.4e-24) 27 5.4 SB_41225| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_36751| Best HMM Match : Exo_endo_phos (HMM E-Value=2e-12) 27 9.5 SB_31184| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_32094| Best HMM Match : RVT_1 (HMM E-Value=1.9e-12) 27 9.5 SB_26778| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_3897| Best HMM Match : DUF1662 (HMM E-Value=4.4) Length = 300 Score = 31.9 bits (69), Expect = 0.25 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 5/62 (8%) Frame = +1 Query: 64 KVKFPYAALSYINVTLCTYTAMLVGYMATFNEFEYLQYW-----FLLSFLMSVALNAPTL 228 +V +PY+ L ++++L T L A EY +YW F + +SV L A Sbjct: 204 RVLYPYSGLCKLDLSLAEVTRRLPSIKAVLQVPEYSEYWRTAECFAIRKGISVVLQASKE 263 Query: 229 WT 234 WT Sbjct: 264 WT 265 >SB_51613| Best HMM Match : DUF1662 (HMM E-Value=4.4) Length = 246 Score = 28.7 bits (61), Expect = 2.3 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +1 Query: 64 KVKFPYAALSYINVTLCTYTAMLVGYMATFNEFEYLQYW 180 +V +PY+ L ++++L T L A EY +YW Sbjct: 204 RVLYPYSGLCKLDLSLAEVTRRLPSIKAVLQVPEYSEYW 242 >SB_25084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 523 Score = 28.7 bits (61), Expect = 2.3 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -1 Query: 254 ASVVLNA-VHKVGAFSATDIKNDNRNQYCKYSNSLNVAMYPTN 129 A +V+N +HK G S I+ D KY +VA+YPTN Sbjct: 306 APIVINRELHKGGDRSCMHIELDITGSGIKYDAGDHVAVYPTN 348 >SB_23572| Best HMM Match : 7tm_1 (HMM E-Value=6.4e-22) Length = 269 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = +1 Query: 139 YMATFNEFEYLQYWFLLSFLMSVALNAPTLWTAFKTTEAHEV 264 Y F L LS ++SVA N LWT F T H V Sbjct: 9 YQENLESFILLSVLSTLSGIVSVAGNFLVLWTIFHTKSLHVV 50 >SB_6552| Best HMM Match : Glyco_transf_9 (HMM E-Value=1.9) Length = 930 Score = 28.3 bits (60), Expect = 3.1 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 Query: 152 STNLNIYNTGFCCR 193 S NLN Y+TG CCR Sbjct: 373 SLNLNCYSTGICCR 386 >SB_1234| Best HMM Match : RVT_1 (HMM E-Value=3.1e-08) Length = 210 Score = 28.3 bits (60), Expect = 3.1 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = +1 Query: 178 WFLLSFLMSVALNAPTLWTAFKTTEAHEVVYEMKLFQAMYFSNVLLNY 321 W + F+ + N+P LW T EVV + +L A N ++ + Sbjct: 127 WLFVLFINDLECNSPHLWKYVDDTTVSEVVLKGELSSAQGLVNDIIEW 174 >SB_57685| Best HMM Match : Pkinase_Tyr (HMM E-Value=7.9) Length = 104 Score = 27.9 bits (59), Expect = 4.1 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = -3 Query: 363 KNKICTHLIVRKHHIIQQHVTKVHGLEQLHFVNYFMGFCGFER 235 + +IC H +++ H+I+ + +V +Q F+ Y G F+R Sbjct: 60 RKEICIHRMLQDVHVIKFYAQRVENSKQYLFLEYSSGGELFDR 102 >SB_19325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 27.9 bits (59), Expect = 4.1 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = -3 Query: 363 KNKICTHLIVRKHHIIQQHVTKVHGLEQLHFVNYFMGFCGFER 235 + +IC H +++ H+I+ + +V +Q F+ Y G F+R Sbjct: 60 RKEICIHRMLQDVHVIKFYAQRVENSKQYLFLEYSSGGELFDR 102 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 27.9 bits (59), Expect = 4.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 52 STDTKVKFPYAALSYINVTLCTYTAML 132 STD +V F + +L N+T TY A+L Sbjct: 2250 STDARVDFKFNSLRPSNITTSTYAALL 2276 >SB_14213| Best HMM Match : RVT_1 (HMM E-Value=1.4e-24) Length = 811 Score = 27.5 bits (58), Expect = 5.4 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -3 Query: 363 KNKICTHLIVRKHHIIQQHVTKVHGLEQLHFVNY 262 ++K+ T R +I ++ + VHGLE+LH+ Y Sbjct: 296 RSKLLTETERRYSNIEREMLAVVHGLEKLHYYAY 329 >SB_41225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 26.6 bits (56), Expect = 9.5 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -3 Query: 354 ICTHLIVRKHHIIQQHVTKVHGLEQLHFVNYFMGFCGFER 235 IC H +++ H+I+ + +V +Q F+ Y G F+R Sbjct: 1 ICIHRMLQDVHVIKFYAQRVENSKQYLFLEYASGGELFDR 40 >SB_36751| Best HMM Match : Exo_endo_phos (HMM E-Value=2e-12) Length = 906 Score = 26.6 bits (56), Expect = 9.5 Identities = 16/65 (24%), Positives = 31/65 (47%) Frame = +1 Query: 166 YLQYWFLLSFLMSVALNAPTLWTAFKTTEAHEVVYEMKLFQAMYFSNVLLNYVVFSDNQM 345 + WF +L V L+ + + F T+ HE + + + + S V+L+ VV + + Sbjct: 729 FCHQWFCHGWLSPVVLSRVVVTSGFVTSGCHEWL-SLVVLSPVVLSPVVLSRVVVTSGFV 787 Query: 346 GTNFV 360 + FV Sbjct: 788 TSGFV 792 >SB_31184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 724 Score = 26.6 bits (56), Expect = 9.5 Identities = 12/48 (25%), Positives = 21/48 (43%) Frame = +1 Query: 178 WFLLSFLMSVALNAPTLWTAFKTTEAHEVVYEMKLFQAMYFSNVLLNY 321 W + F+ + N+P LW T EVV + + A N ++ + Sbjct: 465 WLFVLFINDLECNSPHLWKYVDDTTVSEVVLKGEFSSAQGLVNDIIEW 512 >SB_32094| Best HMM Match : RVT_1 (HMM E-Value=1.9e-12) Length = 642 Score = 26.6 bits (56), Expect = 9.5 Identities = 12/48 (25%), Positives = 21/48 (43%) Frame = +1 Query: 178 WFLLSFLMSVALNAPTLWTAFKTTEAHEVVYEMKLFQAMYFSNVLLNY 321 W + F+ + N+P LW T EVV + + A N ++ + Sbjct: 383 WLFVLFINDLECNSPHLWKYVDDTTVSEVVLKGEFSSAQGLVNDIIEW 430 >SB_26778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1050 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -1 Query: 194 NDNRNQYCKYSNSLNVAMYPT 132 NDN N YC N+LN + Y T Sbjct: 240 NDNCNTYCISQNNLNGSYYAT 260 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,335,966 Number of Sequences: 59808 Number of extensions: 283736 Number of successful extensions: 688 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 601 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 687 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 896151577 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -