BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10j02 (691 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 24 1.3 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 1.8 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 7.2 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 9.5 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 23.8 bits (49), Expect = 1.3 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 643 PMTMNVKIHHHQMSL 687 P T N +HHHQ SL Sbjct: 127 PPTDNSHVHHHQTSL 141 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 23.4 bits (48), Expect = 1.8 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 4/36 (11%) Frame = -2 Query: 690 LQTHLMMMNLYVHCHR----VDQDLHGTWIFQLQNL 595 LQ + + NL +H + +D ++ G W +LQNL Sbjct: 584 LQFNDGLKNLEIHVTKDTDTLDNEMRGAWPLKLQNL 619 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 499 TTQSSNSTRALMKNLGATPF 440 T Q S TR +KN A+P+ Sbjct: 249 TVQLSTCTRTTLKNNRASPY 268 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.0 bits (42), Expect = 9.5 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 252 SDDEEETKRVVRSMKEKRYEELEGII 329 SD++EE + +S K K Y G + Sbjct: 41 SDNDEEERPSFKSRKPKNYSAPIGFV 66 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,127 Number of Sequences: 336 Number of extensions: 2384 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -