BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10j02 (691 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56150.1 68416.m06241 eukaryotic translation initiation facto... 98 6e-21 At3g22860.1 68416.m02882 eukaryotic translation initiation facto... 79 3e-15 At5g21900.1 68418.m02539 expressed protein 30 1.7 At1g10800.1 68414.m01239 hypothetical protein 29 2.9 At3g51740.1 68416.m05673 leucine-rich repeat transmembrane prote... 28 5.1 At2g22720.3 68415.m02692 expressed protein 28 6.7 At2g22720.2 68415.m02691 expressed protein 28 6.7 At2g22720.1 68415.m02693 expressed protein 28 6.7 At5g05870.1 68418.m00645 UDP-glucoronosyl/UDP-glucosyl transfera... 27 8.9 At4g02720.1 68417.m00368 expressed protein temporary automated f... 27 8.9 At3g54750.2 68416.m06058 expressed protein 27 8.9 At3g54750.1 68416.m06057 expressed protein 27 8.9 At3g16000.1 68416.m02024 matrix-localized MAR DNA-binding protei... 27 8.9 >At3g56150.1 68416.m06241 eukaryotic translation initiation factor 3 subunit 8 / eIF3 p110 / eIF3c / p105 (TIF3C1) nearly identical to SP|O49160 Eukaryotic translation initiation factor 3 subunit 8 (eIF3 p110) (eIF3c) (p105) {Arabidopsis thaliana} Length = 900 Score = 97.9 bits (233), Expect = 6e-21 Identities = 47/134 (35%), Positives = 85/134 (63%) Frame = +3 Query: 255 DDEEETKRVVRSMKEKRYEELEGIIHSIRNHRKIKDFSSALASFEELQKAYTRAAPVVQK 434 DD+ +TKRVV+ K+KR+EE+ + ++N KI D+ S +F+++ K + + + Sbjct: 43 DDDTDTKRVVKPAKDKRFEEMTYTVDQMKNAMKINDWVSLQENFDKVNKQLEKVMRITEA 102 Query: 435 EENGVAPRFFIRALVELDDWVVGAWNEREARKALSKGNSKALTSLRQKLRKYTKDFEAEI 614 + P +I+ LV L+D++ A +EA+K +S NSKAL S++QKL+K K +E +I Sbjct: 103 VK---PPTLYIKTLVMLEDFLNEALANKEAKKKMSTSNSKALNSMKQKLKKNNKLYEDDI 159 Query: 615 SKFREDPDLPDDNE 656 +K+RE P++ ++ + Sbjct: 160 NKYREAPEVEEEKQ 173 >At3g22860.1 68416.m02882 eukaryotic translation initiation factor 3 subunit 8, putative / eIF3c, putative similar to eukaryotic translation initiation factor 3 subunit 8 (eIF3 p110) [Arabidopsis thaliana] SWISS-PROT:O49160 Length = 800 Score = 79.0 bits (186), Expect = 3e-15 Identities = 42/130 (32%), Positives = 76/130 (58%) Frame = +3 Query: 267 ETKRVVRSMKEKRYEELEGIIHSIRNHRKIKDFSSALASFEELQKAYTRAAPVVQKEENG 446 +TKRVV+ K+KR+EE+ I ++++ I D +FE+L K +++ Sbjct: 42 DTKRVVKPKKDKRFEEMANTIENMKHAMNINDCVYLQETFEKLNKQISKSVKT------- 94 Query: 447 VAPRFFIRALVELDDWVVGAWNEREARKALSKGNSKALTSLRQKLRKYTKDFEAEISKFR 626 P +I+ LV L+D++ + + ++ +S NSKAL ++RQKL+K ++ +I +FR Sbjct: 95 --PTLYIKTLVMLEDFLNE--DNMKTKEKMSTSNSKALNAMRQKLKKNNLQYQEDIKRFR 150 Query: 627 EDPDLPDDNE 656 E P++ DD+E Sbjct: 151 ESPEIEDDDE 160 >At5g21900.1 68418.m02539 expressed protein Length = 544 Score = 29.9 bits (64), Expect = 1.7 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Frame = +3 Query: 270 TKRVVRSMKEKRYEELEGI-IHSIRNHRKIKDFSSALASFEELQKAYTRAAPVVQKEENG 446 T R +R + +K L G+ I + +K K FSS+L FE+L Y A +V + Sbjct: 295 TYRALRILADKFGSTLRGLSIGGCQGIKKHKGFSSSLYKFEKLN--YLSVAGLVSVNDGV 352 Query: 447 VAPRFFIRALVELD 488 V F R+ + D Sbjct: 353 VRSFFMFRSSILTD 366 >At1g10800.1 68414.m01239 hypothetical protein Length = 118 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = +3 Query: 528 KALSKGNSKALTSLRQKLRKYTKDFEAEISKFREDPDLP 644 +ALSK N L +L +K + K E E+++F+E+ D+P Sbjct: 77 QALSKENRTLLETLAEK-DEVIKMLEEELNRFKENGDIP 114 >At3g51740.1 68416.m05673 leucine-rich repeat transmembrane protein kinase, putative brassinosteroid-insensitive protein BRI1 - Arabidopsis thaliana, PIR:T09356 Length = 836 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 525 RKALSKGNSKALTSLRQKLRKYTKDFEAEIS 617 + L GN A+ LR+K K K+FE E++ Sbjct: 553 KATLEDGNEVAVKRLREKTTKGVKEFEGEVT 583 >At2g22720.3 68415.m02692 expressed protein Length = 569 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/56 (26%), Positives = 30/56 (53%) Frame = +3 Query: 273 KRVVRSMKEKRYEELEGIIHSIRNHRKIKDFSSALASFEELQKAYTRAAPVVQKEE 440 K+ RS ++ ++ L ++ R R D + A FE++QK R+A + ++E+ Sbjct: 490 KKPARSEDQEAFDMLRQLLPPKRFSRYDDDDINMEAGFEDIQKEERRSARIAREED 545 >At2g22720.2 68415.m02691 expressed protein Length = 672 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/56 (26%), Positives = 30/56 (53%) Frame = +3 Query: 273 KRVVRSMKEKRYEELEGIIHSIRNHRKIKDFSSALASFEELQKAYTRAAPVVQKEE 440 K+ RS ++ ++ L ++ R R D + A FE++QK R+A + ++E+ Sbjct: 593 KKPARSEDQEAFDMLRQLLPPKRFSRYDDDDINMEAGFEDIQKEERRSARIAREED 648 >At2g22720.1 68415.m02693 expressed protein Length = 340 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/56 (26%), Positives = 30/56 (53%) Frame = +3 Query: 273 KRVVRSMKEKRYEELEGIIHSIRNHRKIKDFSSALASFEELQKAYTRAAPVVQKEE 440 K+ RS ++ ++ L ++ R R D + A FE++QK R+A + ++E+ Sbjct: 261 KKPARSEDQEAFDMLRQLLPPKRFSRYDDDDINMEAGFEDIQKEERRSARIAREED 316 >At5g05870.1 68418.m00645 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 464 Score = 27.5 bits (58), Expect = 8.9 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +3 Query: 264 EETKRVVRSMKEKRYEELEGIIHSIRN--HRKIKDFSSALASFEEL 395 E + V+R M E + EE+ G I +R+ R +K S+ S +EL Sbjct: 405 EIERAVIRLMVESKGEEIRGRIKVLRDEVRRSVKQGGSSYRSLDEL 450 >At4g02720.1 68417.m00368 expressed protein temporary automated functional assignment Length = 422 Score = 27.5 bits (58), Expect = 8.9 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Frame = +3 Query: 252 SDDEEETKRVVRSMKEKRYEELEG-IIHSIRNHRKIKDFSSALASFEELQKAYTRAAPVV 428 SD EEE +R R KR + R+HR+ +S + S +E KA A+ Sbjct: 142 SDSEEEDRRRRRKSSSKRKKSRSSRSFRKKRSHRRKTKYSDSDESSDEDSKAEISASSSG 201 Query: 429 QKEE 440 ++E+ Sbjct: 202 EEED 205 >At3g54750.2 68416.m06058 expressed protein Length = 589 Score = 27.5 bits (58), Expect = 8.9 Identities = 18/57 (31%), Positives = 27/57 (47%) Frame = -1 Query: 625 RNLDISASKSLVYFLSFCLSEVRALLFPFDRAFRASRSFHAPTTQSSNSTRALMKNL 455 R+L K+L C S+ A+ + A RS + TQS+ RA++KNL Sbjct: 315 RSLYFMFRKNLCKVFYVCTSQFVAMFTGSCESGGAKRSCNGYITQSTRRLRAMLKNL 371 >At3g54750.1 68416.m06057 expressed protein Length = 589 Score = 27.5 bits (58), Expect = 8.9 Identities = 18/57 (31%), Positives = 27/57 (47%) Frame = -1 Query: 625 RNLDISASKSLVYFLSFCLSEVRALLFPFDRAFRASRSFHAPTTQSSNSTRALMKNL 455 R+L K+L C S+ A+ + A RS + TQS+ RA++KNL Sbjct: 315 RSLYFMFRKNLCKVFYVCTSQFVAMFTGSCESGGAKRSCNGYITQSTRRLRAMLKNL 371 >At3g16000.1 68416.m02024 matrix-localized MAR DNA-binding protein-related similar to matrix-localized MAR DNA binding protein MFP1 GI:1771158 from [Lycopersicon esculentum] Length = 726 Score = 27.5 bits (58), Expect = 8.9 Identities = 28/125 (22%), Positives = 58/125 (46%), Gaps = 1/125 (0%) Frame = +3 Query: 285 RSMKEKRYEELEGIIHSIRNHRKIKDFSSALASFEELQKAYTRAAPVVQKEENGVAPRFF 464 + ++ + +ELEG+ H ++ +K+ S E+ K + +++E+ V Sbjct: 514 KDLRRRVKDELEGVTHELKES-SVKN-QSLQKELVEIYKKVETSNKELEEEKKTVLS--L 569 Query: 465 IRALVELDDWVVGAWNEREARKALSKGNSKALTSLRQKLRKYTKDFEAEISKFR-EDPDL 641 + + ++ ++ EREARK+L +A+ SL ++ K T E+ K +L Sbjct: 570 NKEVKGMEKQIL---MEREARKSLETDLEEAVKSL-DEMNKNTSILSRELEKVNTHASNL 625 Query: 642 PDDNE 656 D+ E Sbjct: 626 EDEKE 630 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,434,002 Number of Sequences: 28952 Number of extensions: 221542 Number of successful extensions: 768 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 746 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 766 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1467502800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -