BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10i24 (762 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 26 0.33 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 25 1.0 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 25 1.0 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 22 5.4 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 9.4 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 26.2 bits (55), Expect = 0.33 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -3 Query: 613 GKQAPAVHKRP*--GRDPSARTHAGPRRTHSARHR 515 GK+ P KR GR P+A T GP+R H+ R R Sbjct: 16 GKRKPIRKKRKFELGR-PAANTKLGPQRIHTVRTR 49 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 24.6 bits (51), Expect = 1.0 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 323 PWSAVASKNAGSVGAVAVDEVPC 391 PWS ++ + A V + VD+ C Sbjct: 285 PWSYMSGEKANEVATILVDDCGC 307 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 24.6 bits (51), Expect = 1.0 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 323 PWSAVASKNAGSVGAVAVDEVPC 391 PWS ++ + A V + VD+ C Sbjct: 285 PWSYMSGEKANEVATILVDDCGC 307 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 256 SAYARTRTGSLYHTL*RRRN 197 S Y++TR +L HTL R N Sbjct: 196 SVYSKTRRRALEHTLDRFHN 215 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.4 bits (43), Expect = 9.4 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 75 FNRHNFLEVI*ISDHGAANEGVRRQPAAGLQT 170 F H ++ +S+ N G +PAAGL T Sbjct: 272 FEPHRIPQLQEVSEFLKKNTGFTLRPAAGLLT 303 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,505 Number of Sequences: 438 Number of extensions: 3828 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -