BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10i23 (498 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26249| Best HMM Match : No HMM Matches (HMM E-Value=.) 223 5e-59 SB_17063| Best HMM Match : Ribosomal_S17 (HMM E-Value=5.7e-06) 34 0.057 SB_48102| Best HMM Match : Ribosomal_S17 (HMM E-Value=4.2e-34) 33 0.099 SB_39731| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_32917| Best HMM Match : Pro_isomerase (HMM E-Value=5.1e-23) 28 3.7 SB_15022| Best HMM Match : Zona_pellucida (HMM E-Value=5.6e-38) 28 4.9 SB_18810| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_43823| Best HMM Match : MAM (HMM E-Value=0) 27 6.5 >SB_26249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 223 bits (546), Expect = 5e-59 Identities = 105/155 (67%), Positives = 127/155 (81%), Gaps = 16/155 (10%) Frame = +1 Query: 25 MADQTEKAFQKQATVFLNRKGGM----KRKDMRHHKNVGLGFKTP------------REA 156 MA+QTE+A+QKQA +F NRK + K+KD+R +NVGLGFKTP REA Sbjct: 1 MAEQTERAYQKQAPIFQNRKRVLGQVTKKKDLRFVRNVGLGFKTPKDVCNCTYLLPEREA 60 Query: 157 IEGTYIDKKCPFTGNVSIRGRILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMS 336 IEGTYIDKKCPFTGNVSIRGRILTG+ + MKM+RTI+IRRDYLHY+ KYNRFEKRH+N++ Sbjct: 61 IEGTYIDKKCPFTGNVSIRGRILTGICRSMKMKRTIIIRRDYLHYIKKYNRFEKRHKNLA 120 Query: 337 VHLSPCFRDVEIGDIVTIGECRPLSKTVRFNVLKV 441 H SPCFRD+ +GD++T+G+CRPLSKTVRFNVLKV Sbjct: 121 AHCSPCFRDIALGDLITVGQCRPLSKTVRFNVLKV 155 >SB_17063| Best HMM Match : Ribosomal_S17 (HMM E-Value=5.7e-06) Length = 73 Score = 34.3 bits (75), Expect = 0.057 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +1 Query: 373 GDIVTIGECRPLSKTVRFNVLKV 441 GD+V I ECRPLSK +FNV ++ Sbjct: 29 GDVVRIKECRPLSKMKKFNVEEI 51 >SB_48102| Best HMM Match : Ribosomal_S17 (HMM E-Value=4.2e-34) Length = 208 Score = 33.5 bits (73), Expect = 0.099 Identities = 22/83 (26%), Positives = 39/83 (46%) Frame = +1 Query: 193 TGNVSIRGRILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHLSPCFRDVEI 372 T + R ++ G+V KM +TI + + P Y + + + H + + Sbjct: 5 TAERTTRRKVREGLVVSDKMNKTITVMVEDRVKHPLYGKVMTKSVRLKAHDEN--NEAGM 62 Query: 373 GDIVTIGECRPLSKTVRFNVLKV 441 GD V I E RPLS T R+ ++++ Sbjct: 63 GDRVRIMETRPLSATKRWRLVEI 85 >SB_39731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 Query: 175 QCRYPQSPLWEF*SLNQHSYGDACP 101 +C QS LWE SL QH Y + P Sbjct: 505 KCNALQSSLWELKSLQQHYYPEVSP 529 >SB_32917| Best HMM Match : Pro_isomerase (HMM E-Value=5.1e-23) Length = 378 Score = 28.3 bits (60), Expect = 3.7 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +1 Query: 43 KAFQKQATVFLNRKGGMKRKDMRHHKNVGLGFKTPREAIEGTYIDKK-CPFTGNVSIRGR 219 +A + T ++RK K+K+ + KN+ K PR T++ + G V++R R Sbjct: 216 QALAMKVTSRVSRKIDSKKKNKQRRKNLRALRKAPRRPAPVTHLSARGADVDGAVALRAR 275 Query: 220 ILTGVVQK 243 G Q+ Sbjct: 276 ARAGNAQR 283 >SB_15022| Best HMM Match : Zona_pellucida (HMM E-Value=5.6e-38) Length = 525 Score = 27.9 bits (59), Expect = 4.9 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +1 Query: 220 ILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHLSPCF 357 I+ VV K K + VI RD+ Y ++ +R VH SP F Sbjct: 64 IMNKVVPKEKEDKNKVITRDHQAYFAFSCKYHRRMVLTVVHFSPSF 109 >SB_18810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -3 Query: 130 NQHSYGDACPSSSCHLS---CSGKRWPVSETLSLSDPPFC 20 N HS D CP+S C+L C + ++ TL P C Sbjct: 33 NDHSDEDDCPNSDCNLEQIYCPVSQKCLNRTLQCDGKPDC 72 >SB_43823| Best HMM Match : MAM (HMM E-Value=0) Length = 1724 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -3 Query: 130 NQHSYGDACPSSSCHLS---CSGKRWPVSETLSLSDPPFC 20 N HS D CP+S C+L C + ++ TL P C Sbjct: 1330 NDHSDEDDCPNSDCNLEQIYCPVSQKCLNRTLQCDGKPDC 1369 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,148,340 Number of Sequences: 59808 Number of extensions: 306933 Number of successful extensions: 747 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -