BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10i19 (679 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 24 1.3 AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esteras... 23 1.7 AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esteras... 23 1.7 AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esteras... 23 1.7 AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esteras... 23 1.7 AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esteras... 23 1.7 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 22 4.0 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 21 7.0 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 21 7.0 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 23.8 bits (49), Expect = 1.3 Identities = 8/30 (26%), Positives = 18/30 (60%) Frame = +1 Query: 130 EQGNLQVKFVAKDIASSLKYVNCKQAVIVN 219 + GN++ + + + + L +VN QA++ N Sbjct: 108 DDGNIKYRTILESVDHRLAFVNSAQALVKN 137 >AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 23.4 bits (48), Expect = 1.7 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -2 Query: 273 GIWYRPRLAVRRFVFFVNINY 211 G +Y+P + + + FVN+NY Sbjct: 128 GSFYQPDYFIDKNIVFVNLNY 148 >AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 23.4 bits (48), Expect = 1.7 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -2 Query: 273 GIWYRPRLAVRRFVFFVNINY 211 G +Y+P + + + FVN+NY Sbjct: 128 GSFYQPDYFIDKNIVFVNLNY 148 >AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 23.4 bits (48), Expect = 1.7 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -2 Query: 273 GIWYRPRLAVRRFVFFVNINY 211 G +Y+P + + + FVN+NY Sbjct: 128 GSFYQPDYFIDKNIVFVNLNY 148 >AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 23.4 bits (48), Expect = 1.7 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -2 Query: 273 GIWYRPRLAVRRFVFFVNINY 211 G +Y+P + + + FVN+NY Sbjct: 128 GSFYQPDYFIDKNIVFVNLNY 148 >AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 23.4 bits (48), Expect = 1.7 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -2 Query: 273 GIWYRPRLAVRRFVFFVNINY 211 G +Y+P + + + FVN+NY Sbjct: 128 GSFYQPDYFIDKNIVFVNLNY 148 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 22.2 bits (45), Expect = 4.0 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = -3 Query: 299 CLTTLSGAGVYGIDPDSLYVVLYFLSTLTITACLQF 192 C T S A YGID + ++ L + LQF Sbjct: 253 CRPTFSAARFYGIDFSNTFLGLVGAVVTFLIVLLQF 288 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 21.4 bits (43), Expect = 7.0 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -3 Query: 443 VHSTCGITSSSSHACN 396 +H+TCG ++ HA N Sbjct: 356 LHATCGTKNALLHAVN 371 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 21.4 bits (43), Expect = 7.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -1 Query: 238 FCIFCQH*LSQLVYNLHILN 179 FC+F Q+ L +++ LH L+ Sbjct: 96 FCLFYQNKLIEVISKLHKLD 115 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,056 Number of Sequences: 336 Number of extensions: 3188 Number of successful extensions: 12 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -