BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10i18 (729 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 24 1.7 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 22 5.2 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 9.0 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 9.0 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -2 Query: 194 SSSATTGPLRLPRPNGKLKMCAFQVD 117 S +TTGP P P K +M A +D Sbjct: 377 SQKSTTGPPPGPTPAQKARMRALNID 402 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = -3 Query: 487 KSLVEFLRSDFMVINIQLLFEIF*ISWFPFF 395 + L +F + + ++ +F I W PFF Sbjct: 322 RKLAKFAKEKKAAKTLGIVMGVFIICWLPFF 352 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -3 Query: 448 INIQLLFEIF*ISWFPFF 395 I + ++ +F I W PFF Sbjct: 272 ITVGVIMGVFLICWVPFF 289 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 9.0 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 420 KISNRSWILITIKSLLRNSTKDFKRT 497 K N S T + LRN T DF+ T Sbjct: 202 KSGNESKKYATSSNSLRNRTHDFQHT 227 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,164 Number of Sequences: 438 Number of extensions: 4762 Number of successful extensions: 19 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -