BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10i17 (548 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53319| Best HMM Match : zf-CW (HMM E-Value=7.7e-17) 29 2.5 SB_30718| Best HMM Match : XPA_N (HMM E-Value=0.55) 29 3.3 >SB_53319| Best HMM Match : zf-CW (HMM E-Value=7.7e-17) Length = 714 Score = 29.1 bits (62), Expect = 2.5 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = +1 Query: 250 DINEEDLKSLCLTKNIAYFTERYNAPTVLKAQPAVYDAFIKHSELFINAICQMDEK 417 D+N+EDL T++ A F R NA T+L+ D+F K I ++ EK Sbjct: 646 DMNDEDLLKAVCTRSKALFRLRRNAYTLLQYLCNDLDSFSKEMIEHTTTIDELIEK 701 >SB_30718| Best HMM Match : XPA_N (HMM E-Value=0.55) Length = 157 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = -2 Query: 247 SRNNC--IQILAFHFWARLNIGLQVR 176 SRN C + IL+ HFW R++ G+ R Sbjct: 125 SRNTCSALGILSLHFWQRVSCGIHPR 150 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,006,858 Number of Sequences: 59808 Number of extensions: 256643 Number of successful extensions: 644 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 643 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -