BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10i13 (840 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55198| Best HMM Match : NUDE_C (HMM E-Value=0.84) 30 2.0 SB_24309| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_39931| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32) 29 6.2 >SB_55198| Best HMM Match : NUDE_C (HMM E-Value=0.84) Length = 649 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -2 Query: 275 LVSVVTT-FHRVGENEWLLPVTGIQEASRLSGHIKVPNGVR 156 LVS+ T F V NE LP +G+ R S H+ VP+ +R Sbjct: 131 LVSLSQTHFGNVSTNEVTLPQSGVTAFRRASAHVPVPDCLR 171 >SB_24309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 303 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/82 (19%), Positives = 37/82 (45%) Frame = -2 Query: 260 TTFHRVGENEWLLPVTGIQEASRLSGHIKVPNGVRVEKLRPNMSVYGTVQLPYDKIKRHA 81 +T R G +W + + + +++ + + + ++ + ++ DK+KR+ Sbjct: 66 STIARQGHKKWRVSGSPRHASRKITQGSRASHATLTDSIKEPLG--RDFEVDEDKVKRYT 123 Query: 80 LEQENKTPNALESCVLFYKDSE 15 E E +T LE C++ D E Sbjct: 124 REDEQQTVERLERCLVKRCDDE 145 >SB_39931| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32) Length = 1023 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/37 (27%), Positives = 22/37 (59%) Frame = +1 Query: 403 SSFNGSKLPSSLKTLIIVFNTSCVKIIELTTPGNWWY 513 S+ + S P+++ T + +T V ++E PG+W++ Sbjct: 25 STTSSSTTPNAVPTSVTTVDTILVNLLEARKPGSWFF 61 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,734,158 Number of Sequences: 59808 Number of extensions: 547254 Number of successful extensions: 1504 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1407 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1504 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2371447782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -