BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10i04 (539 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22884| Best HMM Match : Tctex-1 (HMM E-Value=9.4e-26) 29 3.2 SB_718| Best HMM Match : RhoGAP (HMM E-Value=0) 28 4.2 >SB_22884| Best HMM Match : Tctex-1 (HMM E-Value=9.4e-26) Length = 439 Score = 28.7 bits (61), Expect = 3.2 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 288 VRSS*NIQRNITMPPNSISIKGCRSGSGSQ 377 V+ S N RN+ PPNS G R GS ++ Sbjct: 397 VKGSANSNRNVPSPPNSAKSHGPRPGSSTR 426 >SB_718| Best HMM Match : RhoGAP (HMM E-Value=0) Length = 598 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +2 Query: 383 VVFVTIRALNLRYFKVNLFCVWKLATSCSGCP*TYILLKLKHLIN 517 VVF T++A + F ++C K +C Y LK KH N Sbjct: 85 VVFCTLKAKHTCNFVSVVYCTLKTKHTCDFVSVLYCTLKAKHTCN 129 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,724,035 Number of Sequences: 59808 Number of extensions: 284209 Number of successful extensions: 467 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 464 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1227799733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -