BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10i03 (551 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X98185-1|CAA66860.1| 123|Anopheles gambiae histone H2B protein. 29 0.10 AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 23 6.7 >X98185-1|CAA66860.1| 123|Anopheles gambiae histone H2B protein. Length = 123 Score = 29.1 bits (62), Expect = 0.10 Identities = 14/56 (25%), Positives = 27/56 (48%) Frame = +2 Query: 200 EQVYPDKDFSLKLKRVINMFLNDEIENDKIYKLVETVDSSNKLSRRQVDFLIHALL 367 +QV+PD S K ++N F+ND E + + + ++ R++ + LL Sbjct: 45 KQVHPDTGISSKAMSIMNSFVNDIFERIARKSRLAHYNKRSTITSREIQTAVRLLL 100 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 23.0 bits (47), Expect = 6.7 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 197 CEQVYPDKDFSLKLKR 244 CE+ YPD F++ L+R Sbjct: 222 CEEPYPDIIFNITLRR 237 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 483,435 Number of Sequences: 2352 Number of extensions: 7974 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51301854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -