BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10h21 (649 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g40660.1 68418.m04936 ATP12 protein-related weak similarity t... 55 5e-08 At3g61710.2 68416.m06916 autophagy protein Apg6 family contains ... 31 0.66 At3g61710.1 68416.m06915 autophagy protein Apg6 family contains ... 31 0.66 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 27 8.1 >At5g40660.1 68418.m04936 ATP12 protein-related weak similarity to SP|P22135 ATP12 protein, mitochondrial precursor {Saccharomyces cerevisiae} Length = 325 Score = 54.8 bits (126), Expect = 5e-08 Identities = 37/99 (37%), Positives = 50/99 (50%), Gaps = 3/99 (3%) Frame = +2 Query: 281 KRFYRGTAVIQND--NKWEVTLDHRRLXTPNGNVLTVGNEPLARAVAVEWDSQ-NETISQ 451 KRFY+ + D N W V LD+R L TP+ L + + LA+A+A EW+ Q E I Sbjct: 87 KRFYKKVTTREADDGNGWTVMLDYRTLKTPSKRPLKLRSLALAKAIAAEWEYQLTEGIRP 146 Query: 452 ATMHLTALCNTALDNPGKLTSHDIVNYLLEYYPTDTLLF 568 TM L L TAL+ LT I+ +L D + F Sbjct: 147 FTMPLMRLACTALERV-PLTRSKIIEHLSRKIHQDLVFF 184 >At3g61710.2 68416.m06916 autophagy protein Apg6 family contains weak similarity to Beclin 1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) (Swiss-Prot:Q14457) [Homo sapiens]; contains Pfam profile PF04111: Autophagy protein Apg6 Length = 386 Score = 31.1 bits (67), Expect = 0.66 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +2 Query: 320 NKWEVTLDHRRLXTPNGNVLTVGNEPLAR--AVAVEWDSQNETISQATMHLTALCN 481 NK V +D + +G T+ N L R A+ VEWD N QA + L +CN Sbjct: 302 NKTNVLIDAFPIRN-DGEFGTINNFRLGRLPAIKVEWDEINAAWGQACLLLHTMCN 356 >At3g61710.1 68416.m06915 autophagy protein Apg6 family contains weak similarity to Beclin 1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) (Swiss-Prot:Q14457) [Homo sapiens]; contains Pfam profile PF04111: Autophagy protein Apg6 Length = 517 Score = 31.1 bits (67), Expect = 0.66 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +2 Query: 320 NKWEVTLDHRRLXTPNGNVLTVGNEPLAR--AVAVEWDSQNETISQATMHLTALCN 481 NK V +D + +G T+ N L R A+ VEWD N QA + L +CN Sbjct: 302 NKTNVLIDAFPIRN-DGEFGTINNFRLGRLPAIKVEWDEINAAWGQACLLLHTMCN 356 >At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 359 Score = 27.5 bits (58), Expect = 8.1 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 11/61 (18%) Frame = -3 Query: 491 PEQYYTMRSNAWW--LVKLFHFV---------NPILQQQHEQEVHSLRLIHSHLVXLDVD 345 P QY+T WW +++ ++ P L+QQ+ ++V + +H V L+VD Sbjct: 78 PPQYFTTAQPNWWGPMMRPAYYCPPQPQTQPPKPYLEQQNAKKVRNDVNVHRDTVRLEVD 137 Query: 344 D 342 D Sbjct: 138 D 138 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,887,219 Number of Sequences: 28952 Number of extensions: 282935 Number of successful extensions: 567 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 566 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1344285648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -