BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10h18 (734 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 25 2.4 AY341156-1|AAR13720.1| 98|Anopheles gambiae BolA protein. 24 4.2 AY341155-1|AAR13719.1| 98|Anopheles gambiae BolA protein. 24 4.2 AY341154-1|AAR13718.1| 98|Anopheles gambiae BolA protein. 24 4.2 AY341153-1|AAR13717.1| 98|Anopheles gambiae BolA protein. 24 4.2 AY341152-1|AAR13716.1| 98|Anopheles gambiae BolA protein. 24 4.2 AY341151-1|AAR13715.1| 98|Anopheles gambiae BolA protein. 24 4.2 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 9.8 AY045760-2|AAK84943.1| 169|Anopheles gambiae D7-related 3 prote... 23 9.8 AJ133854-1|CAB39729.1| 169|Anopheles gambiae D7-related 3 prote... 23 9.8 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 9.8 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 25.0 bits (52), Expect = 2.4 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +2 Query: 227 QLSSEALEAGRICCNKYLVKNCGKDQFHIRMRLH 328 +L+ E L G CN + K CGK HIR H Sbjct: 487 RLTFERLSGG---CNLHRCKLCGKVVTHIRNHYH 517 >AY341156-1|AAR13720.1| 98|Anopheles gambiae BolA protein. Length = 98 Score = 24.2 bits (50), Expect = 4.2 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -2 Query: 97 FIFAVPVASRWPAPHGDLYKVTPQPRKTAGNG 2 F+ A+ + ++ P + YK+ P P G G Sbjct: 66 FVHALSIVAKTPQQWDEAYKLEPSPNCKGGFG 97 >AY341155-1|AAR13719.1| 98|Anopheles gambiae BolA protein. Length = 98 Score = 24.2 bits (50), Expect = 4.2 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -2 Query: 97 FIFAVPVASRWPAPHGDLYKVTPQPRKTAGNG 2 F+ A+ + ++ P + YK+ P P G G Sbjct: 66 FVHALSIVAKTPQQWDEAYKLEPSPNCKGGFG 97 >AY341154-1|AAR13718.1| 98|Anopheles gambiae BolA protein. Length = 98 Score = 24.2 bits (50), Expect = 4.2 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -2 Query: 97 FIFAVPVASRWPAPHGDLYKVTPQPRKTAGNG 2 F+ A+ + ++ P + YK+ P P G G Sbjct: 66 FVHALSIVAKTPQQWDEAYKLEPSPNCKGGFG 97 >AY341153-1|AAR13717.1| 98|Anopheles gambiae BolA protein. Length = 98 Score = 24.2 bits (50), Expect = 4.2 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -2 Query: 97 FIFAVPVASRWPAPHGDLYKVTPQPRKTAGNG 2 F+ A+ + ++ P + YK+ P P G G Sbjct: 66 FVHALSIVAKTPQQWDEAYKLEPSPNCKGGFG 97 >AY341152-1|AAR13716.1| 98|Anopheles gambiae BolA protein. Length = 98 Score = 24.2 bits (50), Expect = 4.2 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -2 Query: 97 FIFAVPVASRWPAPHGDLYKVTPQPRKTAGNG 2 F+ A+ + ++ P + YK+ P P G G Sbjct: 66 FVHALSIVAKTPQQWDEAYKLEPSPNCKGGFG 97 >AY341151-1|AAR13715.1| 98|Anopheles gambiae BolA protein. Length = 98 Score = 24.2 bits (50), Expect = 4.2 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -2 Query: 97 FIFAVPVASRWPAPHGDLYKVTPQPRKTAGNG 2 F+ A+ + ++ P + YK+ P P G G Sbjct: 66 FVHALSIVAKTPQQWDEAYKLEPSPNCKGGFG 97 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.0 bits (47), Expect = 9.8 Identities = 9/25 (36%), Positives = 10/25 (40%) Frame = -1 Query: 653 GGTAQYSRHWRGGPLHAASQTHHVH 579 GG + H GG A HH H Sbjct: 703 GGGGHHLSHHHGGAAAATGHHHHQH 727 >AY045760-2|AAK84943.1| 169|Anopheles gambiae D7-related 3 protein protein. Length = 169 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/14 (57%), Positives = 13/14 (92%) Frame = -2 Query: 553 YVDLLTSGELELGT 512 YV+LL +G+L++GT Sbjct: 136 YVELLRAGKLDMGT 149 >AJ133854-1|CAB39729.1| 169|Anopheles gambiae D7-related 3 protein protein. Length = 169 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/14 (57%), Positives = 13/14 (92%) Frame = -2 Query: 553 YVDLLTSGELELGT 512 YV+LL +G+L++GT Sbjct: 136 YVELLRAGKLDMGT 149 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.0 bits (47), Expect = 9.8 Identities = 17/63 (26%), Positives = 28/63 (44%) Frame = +3 Query: 474 VTGGRHRSSRLCAVPSSSSPDVKRSTYQRSGVSQSMNVMSLRSCVKRAASPMTAVLCSTA 653 ++G R +RL S SP S +R + Q ++ CV+R+ +LCS+ Sbjct: 4 LSGKRPSGARLSI--SRGSPTGVYSVRRRWSLCQKLHFRDQVCCVQRSPPHWPYLLCSSC 61 Query: 654 RNM 662 M Sbjct: 62 SAM 64 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 875,524 Number of Sequences: 2352 Number of extensions: 19792 Number of successful extensions: 42 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -