BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10h17 (781 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 24 1.8 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 24 1.8 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 2.4 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 3.2 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 9.7 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 23.8 bits (49), Expect = 1.8 Identities = 14/56 (25%), Positives = 24/56 (42%) Frame = +1 Query: 436 DNRLNYEQALASVARLNYELEQSVTGSGKLHYADQNRLAYDPAVDTMCADPPYLLQ 603 D+ + Y A+V RLN + + G++ + YD + + A P LQ Sbjct: 44 DDEITYNIISAAVNRLNIPANEILELFGRMFFEFCQDSGYDKILQVLGATPRDFLQ 99 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 23.8 bits (49), Expect = 1.8 Identities = 14/56 (25%), Positives = 24/56 (42%) Frame = +1 Query: 436 DNRLNYEQALASVARLNYELEQSVTGSGKLHYADQNRLAYDPAVDTMCADPPYLLQ 603 D+ + Y A+V RLN + + G++ + YD + + A P LQ Sbjct: 44 DDEITYNIISAAVNRLNIPANEILELFGRMFFEFCQDSGYDKILQVLGATPRDFLQ 99 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 Query: 35 EALNWCAPNRR 3 E LN CAPNRR Sbjct: 1690 EELNHCAPNRR 1700 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 23.0 bits (47), Expect = 3.2 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 65 RTIKIGIYLVESEFKVQREIILHR 136 R ++ + ESEF++Q +IIL R Sbjct: 507 RNFRVRSDVKESEFRLQADIILKR 530 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.4 bits (43), Expect = 9.7 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -3 Query: 350 RSRGAAHGGTAASRGVSTSSIADRAPAPTHYYN 252 RSR G + + S ++ PAP +Y N Sbjct: 314 RSRDRRGRGRSREHRIIPSHYIEQIPAPVYYGN 346 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,761 Number of Sequences: 438 Number of extensions: 3518 Number of successful extensions: 22 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24518154 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -