BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10h16 (656 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transpo... 26 0.91 DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted ... 23 6.4 AY146755-1|AAO12070.1| 320|Anopheles gambiae odorant-binding pr... 23 8.5 AY146754-1|AAO12069.1| 334|Anopheles gambiae odorant-binding pr... 23 8.5 AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprote... 23 8.5 >AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transporter Ag_AAT8 protein. Length = 636 Score = 26.2 bits (55), Expect = 0.91 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 514 IVMAIFGTMASTLPAGGSGVIYF 582 +VMA+ A TLP G++YF Sbjct: 291 VVMAVLLVRACTLPGAVDGIVYF 313 >DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted polypeptide protein. Length = 125 Score = 23.4 bits (48), Expect = 6.4 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -3 Query: 594 CYITEVNHAGTTCW*SRCHGPKYCHNNYY*EAHFGKALPK 475 CY T ++ AG RC+ YC + + E G+ +PK Sbjct: 72 CYGTVLDCAG------RCYAECYCASGFVREYPGGRCIPK 105 >AY146755-1|AAO12070.1| 320|Anopheles gambiae odorant-binding protein AgamOBP32 protein. Length = 320 Score = 23.0 bits (47), Expect = 8.5 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = -3 Query: 414 PYI*RAKSTYKNIKCYYESVINL 346 P++ + Y++ +CYYE N+ Sbjct: 123 PHVDVCERAYESFRCYYEQYGNI 145 >AY146754-1|AAO12069.1| 334|Anopheles gambiae odorant-binding protein AgamOBP33 protein. Length = 334 Score = 23.0 bits (47), Expect = 8.5 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = -3 Query: 414 PYI*RAKSTYKNIKCYYESVINL 346 P++ + Y++ +CYYE N+ Sbjct: 123 PHVDVCERAYESFRCYYEQYGNI 145 >AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprotein protein. Length = 470 Score = 23.0 bits (47), Expect = 8.5 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +1 Query: 529 FGTMASTLPAGGSGVIYFCYITTSLCSNLSAAIFC 633 FG + + AG V+ + ++T ++ SNL A C Sbjct: 302 FGALIVGVMAGVISVLGYRFLTPAILSNLRIADTC 336 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 743,330 Number of Sequences: 2352 Number of extensions: 14897 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -