BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10h08 (507 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS... 202 5e-54 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 3.4 >Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS11 protein. Length = 151 Score = 202 bits (493), Expect = 5e-54 Identities = 96/139 (69%), Positives = 115/139 (82%), Gaps = 1/139 (0%) Frame = +3 Query: 21 MADQTE-KAFQKQATVFLNRKGGMKRKDMRHHKNVGLGFKTPREAIEGTYIDKKCPFTGN 197 MADQ +AFQKQ + LNRK ++K +R H ++GLGFKTP+EAI GTYIDKKCPFTG+ Sbjct: 1 MADQQNIRAFQKQLGINLNRKNVSRKKGLRMHHSIGLGFKTPKEAITGTYIDKKCPFTGH 60 Query: 198 VSIRGRILTGVVQKMKMQRTIVIRRDYLHYLPKYNRFEKRHRNMSVHLSPCFRDVEIGDI 377 +SIRGRILTGVV+K + + IRRDYL ++ KY+ FEKR+RNM +HLSPCFRDVE GDI Sbjct: 61 ISIRGRILTGVVRKCIV--LLYIRRDYLQFIRKYDTFEKRNRNMRLHLSPCFRDVEAGDI 118 Query: 378 VTIGECRPLSKTVRFNVLK 434 VT+GECRPLSKTVRFNVLK Sbjct: 119 VTLGECRPLSKTVRFNVLK 137 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.8 bits (49), Expect = 3.4 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 224 GEDAAADRNVASEGTLLVNVGT 159 GED D+ S+GTLL +GT Sbjct: 1268 GEDDTGDKKTDSDGTLL-EIGT 1288 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 514,120 Number of Sequences: 2352 Number of extensions: 9870 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45668772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -