BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10h06 (706 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 27 0.43 AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 26 1.0 CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein ... 26 1.3 AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. 26 1.3 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 26 1.3 AY524130-1|AAS17758.1| 211|Anopheles gambiae superoxide dismuta... 24 5.4 AY146741-1|AAO12101.1| 131|Anopheles gambiae odorant-binding pr... 23 7.1 AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein ... 23 7.1 DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 23 9.4 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 27.5 bits (58), Expect = 0.43 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 8/68 (11%) Frame = -1 Query: 466 IPHGRATRPLGLLDLSVPTVKQNVFIVV---NHLLLAFG-----HFAFVLHDRHYVEDIV 311 IP+ R RP+ L ++++P +Q F +HLLL G F L ++ +D V Sbjct: 556 IPYERTFRPMALSNINLPETEQFRFCNCGWPHHLLLPKGTAEGMKFDLFLMISNFADDTV 615 Query: 310 NVLFFQEI 287 N F ++I Sbjct: 616 NQEFNEDI 623 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 26.2 bits (55), Expect = 1.0 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -2 Query: 633 KFALVSTAVCLFLLAGIAALSLEDDDVDRSAIFLPI 526 +F + T + L +L SLED DVDR + PI Sbjct: 445 RFGKLQTCLGLAMLLKSYTFSLEDCDVDRPLLIDPI 480 >CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein protein. Length = 277 Score = 25.8 bits (54), Expect = 1.3 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 244 LLQQIQHGPANCYCKFLGKKEH*LYPQRNACHAGR 348 LL+Q+ HG + C + +K P R AC G+ Sbjct: 170 LLRQLNHGGDHAECGQVERKSQPFGPARWACKLGK 204 >AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. Length = 259 Score = 25.8 bits (54), Expect = 1.3 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 125 AGRFKGLQKSNMVNMPEQQSSTETAAVCKNE 217 A K + ++ N P+QQS+T C+N+ Sbjct: 118 AAELKNMVLQDISNQPKQQSTTRPLRKCRNK 148 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 25.8 bits (54), Expect = 1.3 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 125 AGRFKGLQKSNMVNMPEQQSSTETAAVCKNE 217 A K + ++ N P+QQS+T C+N+ Sbjct: 119 AAELKNMVLQDISNQPKQQSTTRPLRKCRNK 149 >AY524130-1|AAS17758.1| 211|Anopheles gambiae superoxide dismutase 2 protein. Length = 211 Score = 23.8 bits (49), Expect = 5.4 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -1 Query: 436 GLLDLSVPTVKQNVFIVVNHLLLAFGHFAFVLHDRHYVED 317 G + +S P+ + VFI +N + L G F +H++ + D Sbjct: 35 GNVTISQPSCTEPVFIDINVVGLTPGKHGFHIHEKGDLTD 74 >AY146741-1|AAO12101.1| 131|Anopheles gambiae odorant-binding protein AgamOBP10 protein. Length = 131 Score = 23.4 bits (48), Expect = 7.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 581 LRCRLKTTMSIGRPFFYPSFQC 516 L C L ++S+ P F P +QC Sbjct: 41 LHCSLSLSLSLLSPSFSPIWQC 62 >AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein S26 protein. Length = 114 Score = 23.4 bits (48), Expect = 7.1 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 40 NVLSVRCVFITNELPGCWALKKYIIKN 120 +V +VRC +P A+KK++I+N Sbjct: 16 HVKAVRCTNCARCVPKDKAIKKFVIRN 42 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 23.0 bits (47), Expect = 9.4 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -2 Query: 162 TMFDFCKPLKRPACILDDIFF*CPTAWQFVCD 67 TM DF P C+LD I + W C+ Sbjct: 150 TMVDFKLLQVIPYCVLDTITYMMGGYWYMACE 181 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 770,078 Number of Sequences: 2352 Number of extensions: 16352 Number of successful extensions: 24 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -