BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10h01 (724 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 27 0.24 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 27 0.24 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 27 0.24 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 23 2.2 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 26.6 bits (56), Expect = 0.24 Identities = 15/61 (24%), Positives = 29/61 (47%) Frame = -1 Query: 262 CSSSRFFNVTFTAFKCVFIATSTPVIVP*TTLPFFNSIVTVSWLSFIKNLTSFILLDLLT 83 CSS RF+ C+ + +I+ + FFN ++ W++F + L+D++ Sbjct: 84 CSSFRFYWDL-----CMLLLLVANLIILPVAISFFNDDLSTRWIAFNCLSDTIFLIDIVV 138 Query: 82 N 80 N Sbjct: 139 N 139 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 26.6 bits (56), Expect = 0.24 Identities = 15/61 (24%), Positives = 29/61 (47%) Frame = -1 Query: 262 CSSSRFFNVTFTAFKCVFIATSTPVIVP*TTLPFFNSIVTVSWLSFIKNLTSFILLDLLT 83 CSS RF+ C+ + +I+ + FFN ++ W++F + L+D++ Sbjct: 84 CSSFRFYWDL-----CMLLLLVANLIILPVAISFFNDDLSTRWIAFNCLSDTIFLIDIVV 138 Query: 82 N 80 N Sbjct: 139 N 139 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 26.6 bits (56), Expect = 0.24 Identities = 15/61 (24%), Positives = 29/61 (47%) Frame = -1 Query: 262 CSSSRFFNVTFTAFKCVFIATSTPVIVP*TTLPFFNSIVTVSWLSFIKNLTSFILLDLLT 83 CSS RF+ C+ + +I+ + FFN ++ W++F + L+D++ Sbjct: 84 CSSFRFYWDL-----CMLLLLVANLIILPVAISFFNDDLSTRWIAFNCLSDTIFLIDIVV 138 Query: 82 N 80 N Sbjct: 139 N 139 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 23.4 bits (48), Expect = 2.2 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +3 Query: 60 RYCFHDKLVNKSSRMKLVRFLMKLSHETVTIELKNGS 170 RYC VN +SRM+ M++ T EL + S Sbjct: 537 RYCLFGDSVNTASRMEATSQAMQIHISQSTKELLSPS 573 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,706 Number of Sequences: 438 Number of extensions: 2785 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -