BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10g24 (713 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0602 - 17884667-17885817,17885946-17886113,17886413-17887313 28 6.4 04_04_1356 + 32854585-32854832,32854948-32855148,32855270-328554... 28 8.5 >04_03_0602 - 17884667-17885817,17885946-17886113,17886413-17887313 Length = 739 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +1 Query: 571 SNCSDSTQTVPGA*RAHIQP--VIGNPITSNYENYSFGVIL 687 S ++TQ VP +I P ++ +TS + YSFGVIL Sbjct: 575 STIDENTQAVPKGTPGYIDPDYLLEYQLTSKNDVYSFGVIL 615 >04_04_1356 + 32854585-32854832,32854948-32855148,32855270-32855447, 32856389-32856651,32856800-32857040,32857317-32858456, 32858856-32858993 Length = 802 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -3 Query: 669 IIFVITSDRVTYHWLNMSPLCSWNCLSTV 583 I+F +TSD +TYH +++ P+ + L V Sbjct: 338 IMFDVTSDYITYHLVDLPPVITLGVLGGV 366 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,738,670 Number of Sequences: 37544 Number of extensions: 280582 Number of successful extensions: 534 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 534 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -