BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10g18 (690 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 25 1.7 AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 23 9.1 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 25.4 bits (53), Expect = 1.7 Identities = 12/56 (21%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +1 Query: 4 IIRKMANTSNITPDIIVNAQINSEDENVLDFIIEDEY-YLKKRGVGAHIIKVASSP 168 I+ + S++TP+ + +++ NV+ ++ + +Y YL+ GV + P Sbjct: 343 ILGDVVEASSLTPNAQLYGSLHNMGHNVIAYVHDPDYRYLEDYGVMGDVTTAMRDP 398 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/41 (24%), Positives = 20/41 (48%) Frame = +1 Query: 67 NSEDENVLDFIIEDEYYLKKRGVGAHIIKVASSPQLRLLYK 189 N +E+ + + E + + G+G H++ P L +YK Sbjct: 331 NDINEDTILSLNEQGHKIDCFGIGTHLVTCQRQPALGCVYK 371 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 536,853 Number of Sequences: 2352 Number of extensions: 8489 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -