BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10g13 (379 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U12964-4|AAA91219.3| 447|Caenorhabditis elegans Temporarily ass... 30 0.48 U20861-7|AAZ32814.2| 120|Caenorhabditis elegans Hypothetical pr... 27 3.4 >U12964-4|AAA91219.3| 447|Caenorhabditis elegans Temporarily assigned gene nameprotein 340 protein. Length = 447 Score = 30.3 bits (65), Expect = 0.48 Identities = 21/55 (38%), Positives = 29/55 (52%) Frame = -1 Query: 325 DDFRSNIRSRKGSRQSYSSNSAKREFDVQPNLNTSPVSFSSDLLSGSRFRSGSTF 161 D+ RSN R R+G RQ S N ++ V P+ +S V +SD FRS + F Sbjct: 173 DEARSNNRHRRGRRQQNSGNQSEAPTAV-PSRVSSGVFIASDY---DEFRSAAEF 223 >U20861-7|AAZ32814.2| 120|Caenorhabditis elegans Hypothetical protein C28H8.13 protein. Length = 120 Score = 27.5 bits (58), Expect = 3.4 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -1 Query: 304 RSRKGSRQSYSSNSAKREFDVQPNLNTSPVSFSSDLLSGSRFRS 173 R+ R+S S + ++ +D+Q NLNT VS + S + RS Sbjct: 31 RAHISDRRSQSRDDFEQSYDLQGNLNTQSVSNGNITTSPYKRRS 74 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,309,584 Number of Sequences: 27780 Number of extensions: 150253 Number of successful extensions: 357 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 340 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 357 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 557037416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -