BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10g11 (691 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) 69 5e-12 SB_16126| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.071 SB_43520| Best HMM Match : RNase_PH (HMM E-Value=0.00011) 34 0.12 SB_36081| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_39230| Best HMM Match : SNF2_N (HMM E-Value=1.40004e-41) 33 0.29 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_3407| Best HMM Match : TPX2 (HMM E-Value=2.9e-09) 32 0.50 SB_11594| Best HMM Match : F5_F8_type_C (HMM E-Value=4.4e-35) 32 0.50 SB_34262| Best HMM Match : efhand (HMM E-Value=6.3e-26) 31 0.67 SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_46753| Best HMM Match : Fimbrial_CS1 (HMM E-Value=1.1) 31 0.67 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_26641| Best HMM Match : FMN_dh (HMM E-Value=0.022) 31 0.88 SB_28690| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.88 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 31 0.88 SB_28794| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_22966| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_53468| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) 30 1.5 SB_46988| Best HMM Match : HEAT (HMM E-Value=8.6e-06) 30 1.5 SB_45585| Best HMM Match : Swi3 (HMM E-Value=0.37) 30 1.5 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 30 1.5 SB_36647| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_12735| Best HMM Match : PT (HMM E-Value=0.36) 30 1.5 SB_59580| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_58137| Best HMM Match : DUF536 (HMM E-Value=2.8) 30 2.0 SB_54715| Best HMM Match : Hexapep (HMM E-Value=1.2e-05) 30 2.0 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_20358| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_1181| Best HMM Match : DUF1604 (HMM E-Value=0) 30 2.0 SB_50891| Best HMM Match : CsbD (HMM E-Value=3.4) 30 2.0 SB_44786| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) 30 2.0 SB_26006| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_13907| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_13535| Best HMM Match : DUF827 (HMM E-Value=7.8) 30 2.0 SB_12991| Best HMM Match : TP2 (HMM E-Value=1.4) 30 2.0 SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 29 2.7 SB_36059| Best HMM Match : TolA (HMM E-Value=0.1) 29 2.7 SB_53872| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_30637| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_8000| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_36664| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 29 4.7 SB_24284| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_57573| Best HMM Match : 7tm_2 (HMM E-Value=3.7e-40) 29 4.7 SB_44333| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_31962| Best HMM Match : DUF1168 (HMM E-Value=1.5) 29 4.7 SB_55200| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) 28 6.2 SB_49614| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) 28 6.2 SB_40579| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) 28 6.2 SB_38133| Best HMM Match : TolA (HMM E-Value=0.38) 28 6.2 SB_38061| Best HMM Match : DUF995 (HMM E-Value=4) 28 6.2 SB_31513| Best HMM Match : Transgly_assoc (HMM E-Value=0.49) 28 6.2 SB_23651| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_16838| Best HMM Match : TolA (HMM E-Value=2) 28 6.2 SB_14388| Best HMM Match : VHS (HMM E-Value=1.8) 28 6.2 SB_11504| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_11449| Best HMM Match : RtcR (HMM E-Value=1.9) 28 6.2 SB_1013| Best HMM Match : Peptidase_M1 (HMM E-Value=0.041) 28 6.2 SB_56701| Best HMM Match : E-MAP-115 (HMM E-Value=0.63) 28 6.2 SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) 28 8.2 SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_1335| Best HMM Match : E-MAP-115 (HMM E-Value=1.6) 28 8.2 SB_982| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_59039| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_55399| Best HMM Match : C1_4 (HMM E-Value=4.8) 28 8.2 SB_51335| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 >SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) Length = 1197 Score = 68.5 bits (160), Expect = 5e-12 Identities = 49/131 (37%), Positives = 75/131 (57%), Gaps = 17/131 (12%) Frame = +3 Query: 162 RLEGTSGDTPGGLIIRQKDKPADFQFAKPSLLGLDKLAAAKRKQNRLISFQNEE------ 323 RLEGT+ D GGLI + K F+ + S+LGL KLA KRK I + + Sbjct: 12 RLEGTN-DMVGGLIKKGSSKHK-FKLPEKSVLGLQKLAEEKRKWKEDIDTSDSKKARLAT 69 Query: 324 ----NEDEGTN-------VDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKREKQ 470 ++D T+ D K+R+YR H EETP++TGG+S++ARE+ + RM+ RE++ Sbjct: 70 GEGLSKDLDTDRYLKSEKGDRQEKKRQYRSHLEETPSHTGGVSDEAREKQLRRME-RERE 128 Query: 471 VKEKGVHNSTQ 503 ++ GV+ T+ Sbjct: 129 SRKYGVYADTK 139 >SB_16126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1056 Score = 34.7 bits (76), Expect = 0.071 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 364 NVNTESTMKKPPPILAVYQSRHGKD-SLSGCRKEKSK*RKKVYTI 495 N NTE T+ + P +L YQ+R K S C + K KKVY I Sbjct: 674 NSNTEETLHRQPLMLDRYQTRRNKKVKKSKCMSAREKREKKVYDI 718 >SB_43520| Best HMM Match : RNase_PH (HMM E-Value=0.00011) Length = 972 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -2 Query: 660 CHFYFYPYLYCPHPYLASYLYPDSFCSHCSFYRVC 556 C+ Y+Y Y YC Y Y Y +C +C +Y C Sbjct: 474 CYCYYYCYCYC---YYYCYYYCYCYCYYCCYYCYC 505 Score = 31.5 bits (68), Expect = 0.67 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = -2 Query: 681 YHDLFYLCHFYFYPYLYCPHPYLASYLYPDSFCSH--CSFYRVC 556 Y+ + C++Y Y Y YC Y Y Y + H C +Y C Sbjct: 477 YYYCYCYCYYYCYYYCYCYCYYCCYYCYCYYYYHHYYCCYYCCC 520 >SB_36081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 424 Score = 33.1 bits (72), Expect = 0.22 Identities = 18/77 (23%), Positives = 37/77 (48%), Gaps = 5/77 (6%) Frame = +3 Query: 267 KLAAAKRKQNRLISFQNEE-----NEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQAR 431 K++ + +KQ ++ ++N N D + + K+RK+ K +EE T + + Sbjct: 316 KISGSGKKQAKVDKYENTSQVKAYNPDADSTIGKSAKKRKHEKSDEEETAATPEVESPPK 375 Query: 432 ERLIERMQKREKQVKEK 482 + E+ K+EK E+ Sbjct: 376 KHKKEKKSKKEKTKTEE 392 >SB_39230| Best HMM Match : SNF2_N (HMM E-Value=1.40004e-41) Length = 1682 Score = 32.7 bits (71), Expect = 0.29 Identities = 24/69 (34%), Positives = 34/69 (49%), Gaps = 6/69 (8%) Frame = +3 Query: 267 KLAAAKRKQNRLISFQNEENEDEGTNVDNVVKERKYR------KHNEETPTYTGGISEQA 428 K+A KRK+ + +S +ENE+E RK R K EET + E+ Sbjct: 685 KMAKGKRKRVKEMSESEDENEEEPDTPSKSKGRRKIRKLLTDEKLGEETKK-ARRLEEER 743 Query: 429 RERLIERMQ 455 R+RL+ER Q Sbjct: 744 RQRLLERTQ 752 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 31.9 bits (69), Expect = 0.50 Identities = 20/58 (34%), Positives = 29/58 (50%) Frame = -1 Query: 301 RRFCLRFAAASLSRPSKEGLAN*KSAGLSFCLMIKPPGVSPEVPSKRWTFSSGSVIVQ 128 +R C R ASLSR ++G +N S G L PP S P ++S +V++Q Sbjct: 47 KRLCSREFCASLSRLQRQGRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQ 104 >SB_3407| Best HMM Match : TPX2 (HMM E-Value=2.9e-09) Length = 787 Score = 31.9 bits (69), Expect = 0.50 Identities = 12/36 (33%), Positives = 25/36 (69%) Frame = +3 Query: 420 EQARERLIERMQKREKQVKEKGVHNSTQEEKKTQAK 527 ++A+ER I MQK EK+++E+ + +EE++ + + Sbjct: 702 KRAQERAIYEMQKHEKEMEEEAILRQREEEREEEER 737 >SB_11594| Best HMM Match : F5_F8_type_C (HMM E-Value=4.4e-35) Length = 1814 Score = 31.9 bits (69), Expect = 0.50 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +3 Query: 255 LGLDKLAAAKRKQNRLISFQNEENEDEGTNVDNVVKERK 371 LGL+K++A+K+ Q L+ +N EN+ + DN E K Sbjct: 547 LGLEKMSASKQTQMLLVELRNNENDYAYSLYDNAFLEPK 585 >SB_34262| Best HMM Match : efhand (HMM E-Value=6.3e-26) Length = 354 Score = 31.5 bits (68), Expect = 0.67 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 1/77 (1%) Frame = +3 Query: 294 NRLISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKREKQ- 470 +++ ++ ENE T D V E Y N E + + + ++ R K+ Sbjct: 88 SKITIVEDSENEVSTTEDDEVFVETTYNTTNAENQDKQTAATVPEDAKHEKHLESRHKER 147 Query: 471 VKEKGVHNSTQEEKKTQ 521 K+K +HNS + KTQ Sbjct: 148 EKKKQIHNSGENLAKTQ 164 >SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 31.5 bits (68), Expect = 0.67 Identities = 15/82 (18%), Positives = 40/82 (48%) Frame = +3 Query: 282 KRKQNRLISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKR 461 +++QN+ + Q ++ + + + +E+K E+ ++ +E +++Q+ Sbjct: 11 EQQQNQELEEQQQKEQKQEVQEEQKQEEQKQEVQEEQKQEVQEEQKQEVQEEQKQKVQEE 70 Query: 462 EKQVKEKGVHNSTQEEKKTQAK 527 +KQ +K QEE+K + + Sbjct: 71 QKQEVQKEQKQEEQEEQKQEVQ 92 Score = 28.3 bits (60), Expect = 6.2 Identities = 16/70 (22%), Positives = 33/70 (47%) Frame = +3 Query: 312 QNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKREKQVKEKGVH 491 Q E+ ++E V +E+K E+ ++ +E + +QK +KQ +++ Sbjct: 31 QEEQKQEE--QKQEVQEEQKQEVQEEQKQEVQEEQKQKVQEEQKQEVQKEQKQEEQEEQK 88 Query: 492 NSTQEEKKTQ 521 QEE+K + Sbjct: 89 QEVQEEQKQE 98 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/82 (17%), Positives = 38/82 (46%) Frame = +3 Query: 282 KRKQNRLISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKR 461 K+++ + + ++ E++ V +E+K E+ ++ +E + Q+ Sbjct: 104 KQEEQKQEVQEEQKQEEQEEQKQEVQEEQKQEVQEEQKQEVQEEQKQEVQEEQKQEEQEE 163 Query: 462 EKQVKEKGVHNSTQEEKKTQAK 527 +KQ +++ QEE+K + + Sbjct: 164 QKQEEQEEQKQEVQEEQKQEVQ 185 >SB_46753| Best HMM Match : Fimbrial_CS1 (HMM E-Value=1.1) Length = 982 Score = 31.5 bits (68), Expect = 0.67 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 6/89 (6%) Frame = +3 Query: 267 KLAAAKRKQNRLISFQNEENE-DEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERL- 440 +LA + R I +++ E E TNVDN+ +++ + P TG E+ + L Sbjct: 745 ELAEENEQSTRSIPCKDKLVEGQEQTNVDNLDEKKDKTDQEQYKPEKTGQEQEKTDQELE 804 Query: 441 ----IERMQKREKQVKEKGVHNSTQEEKK 515 ++ Q E++ +KG QE+ K Sbjct: 805 KPDMVQEKQDNEQEKPDKGEEKQDQEQGK 833 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 31.5 bits (68), Expect = 0.67 Identities = 17/72 (23%), Positives = 36/72 (50%) Frame = +3 Query: 300 LISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKREKQVKE 479 + S ++E +E D+ +E + +EE+ + E++ E E ++ E+++KE Sbjct: 676 IYSSEDESEGEESEQEDDDKEESESESESEESEEESEE-EEESEESDSEESEEEEEEIKE 734 Query: 480 KGVHNSTQEEKK 515 K + +EE K Sbjct: 735 KDIAEQLEEENK 746 >SB_26641| Best HMM Match : FMN_dh (HMM E-Value=0.022) Length = 181 Score = 31.1 bits (67), Expect = 0.88 Identities = 18/85 (21%), Positives = 42/85 (49%), Gaps = 5/85 (5%) Frame = +3 Query: 261 LDKLAAAKRK---QNRLISFQNEENEDEGTNVDNVVKERKYRKHNEE--TPTYTGGISEQ 425 LDK+ +A+++ +N ++ N+E + + ++N ++ K+R+ ++ T I Sbjct: 23 LDKIVSAEQENDSENIIVIIDNKEQHTDNSKINNSIQPTKHRRKRQQKLDSTKPSSIQRL 82 Query: 426 ARERLIERMQKREKQVKEKGVHNST 500 A R++ +Q + + GV T Sbjct: 83 ACCRIVNAVQSKLSVYMDGGVRLDT 107 >SB_28690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2179 Score = 31.1 bits (67), Expect = 0.88 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 8/94 (8%) Frame = +3 Query: 147 EENVHRLEGTSGDTPGGLIIRQKDK------PADFQFAKPS--LLGLDKLAAAKRKQNRL 302 E+ ++ ++ TPG L +R + + PAD Q + P L +D+L A K+ Sbjct: 103 EKEYPLVDSSNRATPGSLNLRIEFRLPGGRSPADLQPSSPGVELEYMDELDAGVGKEGTS 162 Query: 303 ISFQNEENEDEGTNVDNVVKERKYRKHNEETPTY 404 E+N+D+G + ++ +E + R + E P + Sbjct: 163 EEDDKEDNDDQGKDREHRKREHRKRYIDWEVPAW 196 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 31.1 bits (67), Expect = 0.88 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 2/85 (2%) Frame = +3 Query: 273 AAAKRKQNRLISFQNEENE--DEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIE 446 A A +++ RL + Q +E E ++ + KER +K EE + +E+ E Sbjct: 335 AKAAKEKERLEAKQKKEQERLEKQAEKEKKEKERLEKKQREEKDRL------EKKEKKEE 388 Query: 447 RMQKREKQVKEKGVHNSTQEEKKTQ 521 +K+E+++ K +EEKK Q Sbjct: 389 EKRKKEEEINAKIEEKKKREEKKKQ 413 >SB_28794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 30.7 bits (66), Expect = 1.2 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -2 Query: 687 FHYHDLFYLCHFYFYPYLYCPHPYLASYLY 598 ++YH +Y ++Y+Y Y Y + Y Y Y Sbjct: 128 YYYHHYYYYYYYYYYYYYYYYYYYYYYYYY 157 Score = 30.3 bits (65), Expect = 1.5 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -2 Query: 687 FHYHDLFYLCHFYFYPYLYCPHPYLASYLY 598 ++Y+ +Y ++Y+Y Y Y H Y Y Y Sbjct: 110 YYYYYYYYYYYYYYYYYYYYYHHYYYYYYY 139 Score = 30.3 bits (65), Expect = 1.5 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -2 Query: 687 FHYHDLFYLCHFYFYPYLYCPHPYLASYLY 598 ++Y+ +Y ++Y+Y Y Y H Y Y Y Sbjct: 111 YYYYYYYYYYYYYYYYYYYYHHYYYYYYYY 140 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -2 Query: 687 FHYHDLFYLCHFYFYPYLYCPHPYLASYLY 598 ++Y+ +Y H+Y+Y Y Y + Y Y Y Sbjct: 122 YYYYYYYYYHHYYYYYYYYYYYYYYYYYYY 151 Score = 28.7 bits (61), Expect = 4.7 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -2 Query: 684 HYHDLFYLCHFYFYPYLYCPHPYLASYLY 598 HY+ +Y ++Y+Y Y Y + Y Y Y Sbjct: 132 HYYYYYYYYYYYYYYYYYYYYYYYYYYYY 160 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -2 Query: 687 FHYHDLFYLCHFYFYPYLYCPHPYLASYLY 598 ++Y+ +Y H Y+Y Y Y + Y Y Y Sbjct: 121 YYYYYYYYYYHHYYYYYYYYYYYYYYYYYY 150 Score = 27.9 bits (59), Expect = 8.2 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -2 Query: 687 FHYHDLFYLCHFYFYPYLYCPHPYLASYLY 598 ++Y+ +Y ++Y+Y Y Y + Y Y Y Sbjct: 106 YYYYYYYYYYYYYYYYYYYYYYYYYHHYYY 135 Score = 27.9 bits (59), Expect = 8.2 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -2 Query: 687 FHYHDLFYLCHFYFYPYLYCPHPYLASYLY 598 +++H +Y ++Y+Y Y Y + Y Y Y Sbjct: 129 YYHHYYYYYYYYYYYYYYYYYYYYYYYYYY 158 Score = 27.9 bits (59), Expect = 8.2 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -2 Query: 687 FHYHDLFYLCHFYFYPYLYCPHPYLASYLY 598 +H++ +Y ++Y+Y Y Y + Y Y Y Sbjct: 130 YHHYYYYYYYYYYYYYYYYYYYYYYYYYYY 159 >SB_22966| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 323 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/42 (28%), Positives = 26/42 (61%) Frame = +3 Query: 267 KLAAAKRKQNRLISFQNEENEDEGTNVDNVVKERKYRKHNEE 392 K ++ K + I+ + N D G+N++N +K +K+R ++E+ Sbjct: 265 KHSSNHEKNDININNNSSSNNDNGSNINNNIKNKKHRSNHEK 306 >SB_53468| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) Length = 583 Score = 30.3 bits (65), Expect = 1.5 Identities = 20/84 (23%), Positives = 38/84 (45%) Frame = +3 Query: 267 KLAAAKRKQNRLISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIE 446 ++ K + RL + E E+E T+ + KER K + E + E++ + + Sbjct: 415 RITRGKSHEGRL---EEERPEEERTHEERSHKERSQEKRSHEKRPH----EERSHKERSQ 467 Query: 447 RMQKREKQVKEKGVHNSTQEEKKT 518 + EK+ E+ H EE++T Sbjct: 468 EKRSHEKRPHEERSHEERSEEERT 491 >SB_46988| Best HMM Match : HEAT (HMM E-Value=8.6e-06) Length = 1231 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/71 (23%), Positives = 37/71 (52%), Gaps = 1/71 (1%) Frame = +3 Query: 312 QNEENEDEGTNVDNVVKERKYRKHNEETP-TYTGGISEQARERLIERMQKREKQVKEKGV 488 Q+ +++D+ + D+ +K + TP T +S+ RER+ + ++ E++ KE+ Sbjct: 886 QDSDSDDDDDDDDDDDDCKKSTLERDMTPRTMRKSLSKSTRERMERKRREEEERAKEQMR 945 Query: 489 HNSTQEEKKTQ 521 ++EK Q Sbjct: 946 IEEIEQEKSKQ 956 >SB_45585| Best HMM Match : Swi3 (HMM E-Value=0.37) Length = 341 Score = 30.3 bits (65), Expect = 1.5 Identities = 26/104 (25%), Positives = 48/104 (46%) Frame = +3 Query: 204 IRQKDKPADFQFAKPSLLGLDKLAAAKRKQNRLISFQNEENEDEGTNVDNVVKERKYRKH 383 IR+K + +F K L DK + K N I +N+E T+ ++E+K + Sbjct: 140 IREKRRKEKEEFEKQRKLKEDKQKEIEEKINEWIDKKNKEILKSKTS-SQKLQEQKQAEK 198 Query: 384 NEETPTYTGGISEQARERLIERMQKREKQVKEKGVHNSTQEEKK 515 E+ T S+ A ++ + KR+ + KE+ + +E+ K Sbjct: 199 EEQNRTIEEK-SKIAFDKWMSEKLKRDSKKKEEEERKAREEKDK 241 >SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) Length = 693 Score = 30.3 bits (65), Expect = 1.5 Identities = 23/92 (25%), Positives = 42/92 (45%), Gaps = 2/92 (2%) Frame = +3 Query: 252 LLGLDKLAAAKRKQNRLISFQNEENEDEGTNVDNVVKERKYRKHN--EETPTYTGGISEQ 425 L+ DK +A N ++F + + E + KE K + E+T E Sbjct: 562 LVQCDKRSATLDPGNIKMAFNHLIEKAEAREKERQKKEEKEESSHSDEDTSRDRNREKEN 621 Query: 426 ARERLIERMQKREKQVKEKGVHNSTQEEKKTQ 521 RER ER +++EK+ ++K ++EK+ + Sbjct: 622 DREREKEREKEKEKEERDKEREKEKEKEKERE 653 Score = 28.3 bits (60), Expect = 6.2 Identities = 20/90 (22%), Positives = 41/90 (45%), Gaps = 1/90 (1%) Frame = +3 Query: 261 LDKLAAAKRKQNRLISFQNEENEDEGTNVD-NVVKERKYRKHNEETPTYTGGISEQARER 437 ++K A ++++ + + + DE T+ D N KE + E ++ RE+ Sbjct: 585 IEKAEAREKERQKKEEKEESSHSDEDTSRDRNREKENDREREKEREKEKEKEERDKEREK 644 Query: 438 LIERMQKREKQVKEKGVHNSTQEEKKTQAK 527 E+ ++REK+ KE+ +K + K Sbjct: 645 EKEKEKEREKE-KEREREKERDRDKSSHKK 673 >SB_36647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/56 (26%), Positives = 29/56 (51%) Frame = +3 Query: 360 KERKYRKHNEETPTYTGGISEQARERLIERMQKREKQVKEKGVHNSTQEEKKTQAK 527 K++K +K EE E+ R+R R ++R ++ KEK +EE++ + + Sbjct: 23 KKQKKKKEEEEEEEEENEEEERRRKRRRRRRRRRRRRKKEKKKKEEEEEEEEEETE 78 >SB_12735| Best HMM Match : PT (HMM E-Value=0.36) Length = 1148 Score = 30.3 bits (65), Expect = 1.5 Identities = 21/98 (21%), Positives = 41/98 (41%), Gaps = 7/98 (7%) Frame = +3 Query: 246 PSLLGLDKLAAAKRKQNRLISFQNEENEDEGTNVDNVV-------KERKYRKHNEETPTY 404 P LD A + K+ +F +E+++ E +++ V ++++ +KH P Sbjct: 891 PDAQTLDSATADQAKEQDSATFPDEKSDGENVDIEEDVPLWKDNEEKQEAQKHQRSLPQA 950 Query: 405 TGGISEQARERLIERMQKREKQVKEKGVHNSTQEEKKT 518 T + +R E + VKEK S E ++ Sbjct: 951 TDTEMKPQEDRHAEAQDEERDSVKEKNRQRSDVERLRS 988 >SB_59580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 999 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/80 (22%), Positives = 39/80 (48%) Frame = +3 Query: 282 KRKQNRLISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKR 461 +RKQ+ ++FQ+ + E T + + + +K EE ++ A++ K+ Sbjct: 791 ERKQSAKLAFQSWNQQKEETLKEKQERLKAKKKEEEEKELEKRSKTKDAKKYFESWKSKK 850 Query: 462 EKQVKEKGVHNSTQEEKKTQ 521 ++++KE H + +E K Q Sbjct: 851 DEELKE--AHRAKMQELKKQ 868 >SB_58137| Best HMM Match : DUF536 (HMM E-Value=2.8) Length = 139 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/54 (29%), Positives = 23/54 (42%) Frame = +3 Query: 306 SFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKREK 467 SF N +N +E + N + R + NEE I E E +ER E+ Sbjct: 8 SFNNRKNNEERSETTNQERLRAIDRKNEELSERNSVIDETLEENQLERENLEER 61 >SB_54715| Best HMM Match : Hexapep (HMM E-Value=1.2e-05) Length = 1143 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +3 Query: 360 KERKYRKHNEETPTYTGGISEQARERLIERMQKREKQVKE-KGVHNSTQEEKKTQAK 527 K RKY + + + G S+ +RER I++ +K++K+ K+ K T E + K Sbjct: 748 KSRKYSTTDSDCSSDDGENSDSSRERSIKKHKKKKKRKKKIKKNRKKTMENESKNEK 804 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 29.9 bits (64), Expect = 2.0 Identities = 23/82 (28%), Positives = 37/82 (45%) Frame = +3 Query: 282 KRKQNRLISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKR 461 + KQ + +E ++ +KERK R+ E Q RE+ ER ++R Sbjct: 279 EEKQKEEAERKKQEKLEKLAKKKEELKERK-RQEKLEQKAKKKEKERQEREKEKEREKER 337 Query: 462 EKQVKEKGVHNSTQEEKKTQAK 527 +Q KEK +E++K Q K Sbjct: 338 IQQEKEKQKERREKEKQKHQEK 359 >SB_20358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1323 Score = 29.9 bits (64), Expect = 2.0 Identities = 24/84 (28%), Positives = 40/84 (47%) Frame = +3 Query: 267 KLAAAKRKQNRLISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIE 446 K+ K+++ + S ++ED+ VK K KH + + + SE RER E Sbjct: 202 KVKKDKKQKAKDSSESLSDSEDDRERRKKKVK--KEIKHKAKDSSESSIDSEDDRERK-E 258 Query: 447 RMQKREKQVKEKGVHNSTQEEKKT 518 R +K +K+ K K S+ E K+ Sbjct: 259 RKKKNKKEKKHKSKETSSSESNKS 282 >SB_1181| Best HMM Match : DUF1604 (HMM E-Value=0) Length = 1035 Score = 29.9 bits (64), Expect = 2.0 Identities = 22/108 (20%), Positives = 49/108 (45%) Frame = +3 Query: 159 HRLEGTSGDTPGGLIIRQKDKPADFQFAKPSLLGLDKLAAAKRKQNRLISFQNEENEDEG 338 ++++ S D G +++K+K + + +K +K +N F+ E+E + Sbjct: 869 NKIDTDSSDVETGRHVKRKEKKRKEKKRRREKDSSEKTRVSKSSKN----FKAAESEKKK 924 Query: 339 TNVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKREKQVKEK 482 K++KYR H+ + T + RER R+ K++ + ++ Sbjct: 925 RK-----KKKKYRGHSSDDSTSDDSSDGERRERSTSRIDKKKNKKAQR 967 >SB_50891| Best HMM Match : CsbD (HMM E-Value=3.4) Length = 311 Score = 29.9 bits (64), Expect = 2.0 Identities = 34/133 (25%), Positives = 57/133 (42%), Gaps = 6/133 (4%) Frame = +3 Query: 147 EENVHRLEGTSGDTPGGLIIRQKDKPADFQFAKPSLLGLDKLAAAKRKQNRLISFQNEEN 326 E+ E G T G ++ K A Q + ++L +++ N+ N+E Sbjct: 128 EQGKRATEQGKGATEQGKGATEQGKEAIEQGKEACEQERERLNKERKRANKDTERVNKET 187 Query: 327 EDEGTNVDNVVKER----KYRKH-NEETPTYTGGISEQARERLIERMQKREKQV-KEKGV 488 E + V KER K RK N+ET +ER ER+ K+++++ KEK Sbjct: 188 ERVNKETERVNKERERVNKERKRANKETERVNKETERVNKER--ERVNKKKERLNKEKEQ 245 Query: 489 HNSTQEEKKTQAK 527 N +E+ + K Sbjct: 246 LNKEKEQLNKERK 258 >SB_44786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +3 Query: 285 RKQNRLISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARE 434 R+QN S +NE+ +++G++ N K KY N + T G++E E Sbjct: 305 RRQNASGSRENEQEQEQGSSSSNFSKTFKY---NPGLSSETSGVNEHGSE 351 >SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) Length = 422 Score = 29.9 bits (64), Expect = 2.0 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 2/68 (2%) Frame = +3 Query: 285 RKQNRLISFQNEENEDEGTNVDNVVKE--RKYRKHNEETPTYTGGISEQARERLIERMQK 458 +K ++ + + +E E E + KE RK K E+ T +++RE+ E+ +K Sbjct: 127 KKSDKELKEEKKEKEKERMKKEEKHKEKTRKEEKEREKEKEKTKKEEKESREK--EKTKK 184 Query: 459 REKQVKEK 482 EK+ KEK Sbjct: 185 EEKESKEK 192 Score = 29.1 bits (62), Expect = 3.6 Identities = 18/54 (33%), Positives = 31/54 (57%) Frame = +3 Query: 366 RKYRKHNEETPTYTGGISEQARERLIERMQKREKQVKEKGVHNSTQEEKKTQAK 527 +K KH E+T E+ RE+ E+ +K EK+ +EK + +EEK+++ K Sbjct: 146 KKEEKHKEKTRK-----EEKEREKEKEKTKKEEKESREK--EKTKKEEKESKEK 192 >SB_26006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +3 Query: 318 EENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKREKQVK 476 E EDE D+ + R E T TGG+S + +E LI+ ++K +K Sbjct: 85 ERPEDEREAEDDFIMPRTSADQLENIRTPTGGMSFKDQETLIQELKKENFDLK 137 >SB_13907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/62 (27%), Positives = 33/62 (53%) Frame = +3 Query: 297 RLISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKREKQVK 476 +L + +E ++E T + + KE+K +K E + +S+ R+R + ++R K K Sbjct: 166 KLDKLEKQEQDEEETRL--LKKEKKKKKQRERASDSSDDVSDDERQRKRDH-KRRRKHRK 222 Query: 477 EK 482 EK Sbjct: 223 EK 224 >SB_13535| Best HMM Match : DUF827 (HMM E-Value=7.8) Length = 154 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = +3 Query: 369 KYRKHNEETPTYTGGISEQARERLIERMQKREKQVKEKGVHNSTQEEKKTQ 521 KY+K +EE ER +E + ++EK+V E+G S+ E+K ++ Sbjct: 74 KYKKMSEERKASGIETDLSEVERGLEEVTEKEKEVSEQGTAKSSCEKKPSR 124 >SB_12991| Best HMM Match : TP2 (HMM E-Value=1.4) Length = 296 Score = 29.9 bits (64), Expect = 2.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -2 Query: 687 FHYHDLFYLCHFYFYPYLYC 628 ++YH +Y ++Y+Y Y YC Sbjct: 276 YYYHYYYYYYYYYYYYYYYC 295 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -2 Query: 681 YHDLFYLCHFYFYPYLYCPHPYLASYLYPDSFCSHC 574 Y+ +Y ++Y+Y Y Y H Y Y Y + +C Sbjct: 260 YYYYYYYYYYYYYYYYYYYHYYYYYYYYYYYYYYYC 295 Score = 27.9 bits (59), Expect = 8.2 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -2 Query: 687 FHYHDLFYLCHFYFYPYLYCPHPYLASYLY 598 ++Y+ +Y ++Y+Y Y Y + Y Y Y Sbjct: 264 YYYYYYYYYYYYYYYHYYYYYYYYYYYYYY 293 >SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 29.5 bits (63), Expect = 2.7 Identities = 23/93 (24%), Positives = 44/93 (47%) Frame = +3 Query: 237 FAKPSLLGLDKLAAAKRKQNRLISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGI 416 F + S L + A R++ R+I + E+ E+E + ER RKH E Sbjct: 141 FDRTSHLSAKNIEARDRERKRII--EKEKEEEEKKRKEEEELER--RKHQERMEIQRRE- 195 Query: 417 SEQARERLIERMQKREKQVKEKGVHNSTQEEKK 515 +E+ ++ + E +K E++ K + +EE++ Sbjct: 196 AEKVKQMMDELRKKEERRRKREEKRRKKKEEQE 228 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 29.5 bits (63), Expect = 2.7 Identities = 24/95 (25%), Positives = 44/95 (46%) Frame = +3 Query: 243 KPSLLGLDKLAAAKRKQNRLISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISE 422 K S + DK K E+ E E D +E K RK ++ E Sbjct: 880 KTSTVPSDKEKKDNEKARLKEMKDKEKIEKEKREKDKREREEKERKRRQQQLEKEK--KE 937 Query: 423 QARERLIERMQKREKQVKEKGVHNSTQEEKKTQAK 527 + ++ LIE+ +KREK+ +++ + ++EK+ +A+ Sbjct: 938 KEKKLLIEK-EKREKEKQKERLREKEEKEKQKEAE 971 Score = 29.5 bits (63), Expect = 2.7 Identities = 23/102 (22%), Positives = 46/102 (45%) Frame = +3 Query: 207 RQKDKPADFQFAKPSLLGLDKLAAAKRKQNRLISFQNEENEDEGTNVDNVVKERKYRKHN 386 R+K+K + K + AK+++ RL+ ++E D ++RK K Sbjct: 949 REKEKQKERLREKEEKEKQKEAERAKKEKERLLQEDKLHEKEEKDRKDK--EKRKVEKEK 1006 Query: 387 EETPTYTGGISEQARERLIERMQKREKQVKEKGVHNSTQEEK 512 E E+ ++ ++R++KR+ KE+ V +E+K Sbjct: 1007 REKDKQV----EKEKKDSLKRVKKRKDSDKERKVKEKEEEQK 1044 >SB_36059| Best HMM Match : TolA (HMM E-Value=0.1) Length = 1936 Score = 29.5 bits (63), Expect = 2.7 Identities = 20/87 (22%), Positives = 42/87 (48%) Frame = +3 Query: 267 KLAAAKRKQNRLISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIE 446 K+ KRK+ + E E+E ++ + +E +++ EQ ++RL Sbjct: 1157 KVVEEKRKEEEAKQRKLAE-EEEKRRLEEMSEEEYDALTDDQKAEVDRKHLEQKKQRLKR 1215 Query: 447 RMQKREKQVKEKGVHNSTQEEKKTQAK 527 M+++EK+ KEK + +E++ + K Sbjct: 1216 EMERQEKERKEKEMQALLEEKRLEEEK 1242 >SB_53872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 29.1 bits (62), Expect = 3.6 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 2/69 (2%) Frame = +3 Query: 312 QNEENEDEGTNVDNVVK--ERKYRKHNEETPTYTGGISEQARERLIERMQKREKQVKEKG 485 +NEE +EG N K + K + E TP + G +Q + + +K EK+ ++K Sbjct: 30 ENEEGNEEGNEGGNEDKHEDGKENEEKEVTPCHDG---QQLIKDEATKPRKSEKKKRQKK 86 Query: 486 VHNSTQEEK 512 + N Q+++ Sbjct: 87 MMNKKQQKR 95 >SB_30637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1137 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +3 Query: 363 ERKYRKHNEETPTYTGGISEQARERLIERMQKREKQVKEKGVHNSTQEEKKTQAK 527 E+K + +E E+ R+ E +K EK+ +E+ +EEKK AK Sbjct: 1037 EKKMKDEQDEIERKKAEEEEKKRKEEEESKKKDEKEKEEEDEDEEEEEEKKEDAK 1091 >SB_8000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -2 Query: 624 HPYLASYLYPDSFCSHCS 571 H ++A+YL +FCSHC+ Sbjct: 133 HKFMATYLRQPTFCSHCN 150 >SB_36664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 28.7 bits (61), Expect = 4.7 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 5/76 (6%) Frame = +3 Query: 315 NEENEDEGTNVDNVVKERKYRKHNEE-----TPTYTGGISEQARERLIERMQKREKQVKE 479 NEE+EDE ERKY EE TY IS R + ER ++ KQ +E Sbjct: 253 NEEDEDENEVEKQEEFERKYNFRFEEPDAAFIKTYPRTISASVRHK-DERRKEARKQREE 311 Query: 480 KGVHNSTQEEKKTQAK 527 + +E+K+ + K Sbjct: 312 R--KKKEKEQKREEIK 325 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 28.7 bits (61), Expect = 4.7 Identities = 19/76 (25%), Positives = 38/76 (50%) Frame = +3 Query: 300 LISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKREKQVKE 479 L + Q E NEDEGT + +K R +E P ++ + ++ M++++K K+ Sbjct: 83 LAAVQEELNEDEGTFQN--LKPLSRRTTKKELPRKQKAETQVMPKESVQEMKQKDKCSKK 140 Query: 480 KGVHNSTQEEKKTQAK 527 G+ ++ ++ AK Sbjct: 141 GGLKSARAVVQRGDAK 156 >SB_24284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 247 Score = 28.7 bits (61), Expect = 4.7 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 2/84 (2%) Frame = +3 Query: 267 KLAAAKRKQNRLISFQNEENEDEGTNVDNVVKER--KYRKHNEETPTYTGGISEQARERL 440 K AA+K+++ + EE E + +ER +YR+ N+E I + ER Sbjct: 17 KKAASKKRRKEQRATAREELERKRQIAREKTRERVRRYRQKNKEEQGQEKEILQNTGERF 76 Query: 441 IERMQKREKQVKEKGVHNSTQEEK 512 R K+ K K T E+K Sbjct: 77 KNRKSKKRVTDKAKDKLPQTPEKK 100 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 28.7 bits (61), Expect = 4.7 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 3/73 (4%) Frame = +3 Query: 312 QNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKR---EKQVKEK 482 + E+E + +E + RK EE + RE ER QK EK+ KE+ Sbjct: 445 ERRREEEERREEEERKREEEERKQREEEEKKREEEERKQREEE-ERKQKEKEEEKKRKEE 503 Query: 483 GVHNSTQEEKKTQ 521 + +EEKKT+ Sbjct: 504 ERKHKEEEEKKTE 516 >SB_57573| Best HMM Match : 7tm_2 (HMM E-Value=3.7e-40) Length = 956 Score = 28.7 bits (61), Expect = 4.7 Identities = 22/83 (26%), Positives = 36/83 (43%), Gaps = 1/83 (1%) Frame = +3 Query: 267 KLAAAKR-KQNRLISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLI 443 K+A+ KR K+ R + + E + + + R+YR+ N+E I + ER Sbjct: 747 KVASTKRRKEQRATAREELERKRQIAREKTRERVRRYRQKNKEEQGQEKKILQNTGERFK 806 Query: 444 ERMQKREKQVKEKGVHNSTQEEK 512 R K+ K K T E+K Sbjct: 807 NRTSKKRVTDKVKDKLPQTPEKK 829 >SB_44333| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 28.7 bits (61), Expect = 4.7 Identities = 32/130 (24%), Positives = 62/130 (47%), Gaps = 13/130 (10%) Frame = +3 Query: 165 LEGTSGDTPG--GLIIRQKDKPADFQFAKPSLLGLDKLAAAKRKQNRLI---SFQNEENE 329 L+ T G T G G ++R+K K Q + ++ + KRKQ ++ +F++ Sbjct: 17 LKDTKGITEGFDGEVVRKKKKERRHQRKQEKVVDV---ITGKRKQKGVLDEDAFKSTPQH 73 Query: 330 DE-------GTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKREK-QVKEKG 485 D+ G NV+ + +RKYR ++ I+E +++ +KR K + E G Sbjct: 74 DDCDMEPSVGENVEKIKNKRKYRTNSNNE------IAEGCDGSRMKKKEKRHKHKFMEFG 127 Query: 486 VHNSTQEEKK 515 +T+++K+ Sbjct: 128 SDVTTKKQKR 137 >SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/68 (25%), Positives = 29/68 (42%) Frame = +3 Query: 312 QNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKREKQVKEKGVH 491 + EE E+E + +E + + EE E+ E E +KR ++ KEK Sbjct: 213 EEEEEEEEEEEEEEEEEEEEEEEEKEEEEEEEEEEEEEEEEEEEEEEEKRRRKKKEKQKK 272 Query: 492 NSTQEEKK 515 + EK+ Sbjct: 273 KRKRNEKE 280 >SB_31962| Best HMM Match : DUF1168 (HMM E-Value=1.5) Length = 205 Score = 28.7 bits (61), Expect = 4.7 Identities = 21/86 (24%), Positives = 36/86 (41%) Frame = +3 Query: 270 LAAAKRKQNRLISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIER 449 +A +R+ R N E E+E T + E + + EE EQ E + Sbjct: 55 MALRRRRNKRRRRKNNTEEEEEQTEEEEEQTEEEEEQTEEE--------EEQTEEEEEQT 106 Query: 450 MQKREKQVKEKGVHNSTQEEKKTQAK 527 ++ E++ KE+G +EE T + Sbjct: 107 EEEEEEEEKEEGKEEDGEEEVVTDER 132 >SB_55200| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) Length = 929 Score = 28.3 bits (60), Expect = 6.2 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 2/84 (2%) Frame = +3 Query: 267 KLAAAKRKQNRLISFQNEENEDEGTNVDNVVKER--KYRKHNEETPTYTGGISEQARERL 440 K AA+K+++ + EE E + +ER +YR+ N+E I + ER Sbjct: 60 KKAASKKRRKEQRATAREELERKRQIAREKTRERVRRYRQKNKEEQGQEKKILQNTGERF 119 Query: 441 IERMQKREKQVKEKGVHNSTQEEK 512 R K+ K K T E+K Sbjct: 120 KNRTSKKRVTDKVKDKLPQTPEKK 143 >SB_49614| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) Length = 838 Score = 28.3 bits (60), Expect = 6.2 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 2/84 (2%) Frame = +3 Query: 267 KLAAAKRKQNRLISFQNEENEDEGTNVDNVVKER--KYRKHNEETPTYTGGISEQARERL 440 K AA+K+++ + EE E + +ER +YR+ N+E I + ER Sbjct: 60 KKAASKKRRKEQRATAREELERKRQIAREKTRERVRRYRQKNKEEQGQEKKILQNTGERF 119 Query: 441 IERMQKREKQVKEKGVHNSTQEEK 512 R K+ K K T E+K Sbjct: 120 KNRTSKKRVTDKVKDKLPQTPEKK 143 >SB_40579| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) Length = 929 Score = 28.3 bits (60), Expect = 6.2 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 2/84 (2%) Frame = +3 Query: 267 KLAAAKRKQNRLISFQNEENEDEGTNVDNVVKER--KYRKHNEETPTYTGGISEQARERL 440 K AA+K+++ + EE E + +ER +YR+ N+E I + ER Sbjct: 60 KKAASKKRRKEQRATAREELERKRQIAREKTRERVRRYRQKNKEEQGQEKKILQNTGERF 119 Query: 441 IERMQKREKQVKEKGVHNSTQEEK 512 R K+ K K T E+K Sbjct: 120 KNRTSKKRVTDKVKDKLPQTPEKK 143 >SB_38133| Best HMM Match : TolA (HMM E-Value=0.38) Length = 2114 Score = 28.3 bits (60), Expect = 6.2 Identities = 19/72 (26%), Positives = 34/72 (47%) Frame = +3 Query: 312 QNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKREKQVKEKGVH 491 +NEE E + +N +E +K+N+E ++ +E E K++K K+K Sbjct: 1895 ENEEEEKKKKKKEN--EEEDDKKNNKEENEEDEKKEKKKKEENEEEDDKKKKTKKKKKKE 1952 Query: 492 NSTQEEKKTQAK 527 QEE + + K Sbjct: 1953 EEEQEEDERRRK 1964 Score = 27.9 bits (59), Expect = 8.2 Identities = 17/71 (23%), Positives = 34/71 (47%), Gaps = 1/71 (1%) Frame = +3 Query: 312 QNEENEDEGTNVD-NVVKERKYRKHNEETPTYTGGISEQARERLIERMQKREKQVKEKGV 488 +NEE +D+ + N +E+K +K E E+ E + +K+E+ +E Sbjct: 1882 ENEEEDDKKEKKEENEEEEKKKKKKENEEEDDKKNNKEENEEDEKKEKKKKEENEEEDDK 1941 Query: 489 HNSTQEEKKTQ 521 T+++KK + Sbjct: 1942 KKKTKKKKKKE 1952 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/82 (18%), Positives = 40/82 (48%) Frame = +3 Query: 282 KRKQNRLISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKR 461 K+K+ + ++++ ++ N ++ KE+K ++ NEE + +++ E ++ Sbjct: 1901 KKKKKKENEEEDDKKNNKEENEEDEKKEKKKKEENEEEDDKK---KKTKKKKKKEEEEQE 1957 Query: 462 EKQVKEKGVHNSTQEEKKTQAK 527 E + + K +HN ++ K Sbjct: 1958 EDERRRKEIHNGFRDNNGRDQK 1979 >SB_38061| Best HMM Match : DUF995 (HMM E-Value=4) Length = 220 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/72 (23%), Positives = 35/72 (48%), Gaps = 4/72 (5%) Frame = +3 Query: 318 EENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKREKQV----KEKG 485 E+NE +G + D+ E ++H+E+ + + +L + +K K++ K K Sbjct: 107 EKNEHDGNSSDSGNSEVTEQEHDEDANSEENDDKPTRKTKLDKAQRKLNKRLRQKKKNKN 166 Query: 486 VHNSTQEEKKTQ 521 V N + E+K + Sbjct: 167 VANGEENERKVK 178 >SB_31513| Best HMM Match : Transgly_assoc (HMM E-Value=0.49) Length = 340 Score = 28.3 bits (60), Expect = 6.2 Identities = 18/69 (26%), Positives = 28/69 (40%) Frame = +3 Query: 261 LDKLAAAKRKQNRLISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERL 440 LD A R++ + Q +N +E + N + R + NEE I E E Sbjct: 163 LDATANTLREEEERNTEQMRKNNEERSETTNQERLRAIDRKNEELSERNSVIDETLEENQ 222 Query: 441 IERMQKREK 467 +ER E+ Sbjct: 223 LERENLEER 231 >SB_23651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1174 Score = 28.3 bits (60), Expect = 6.2 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 3/72 (4%) Frame = +3 Query: 312 QNEENEDEGTNVDNVVKERKYRKHNE--ETPTYTGGISEQA-RERLIERMQKREKQVKEK 482 +NEE E + +ER+ K E E P+Y + A +ER ++++ E+ KEK Sbjct: 912 ENEEGEVSSWRRKRLEREREREKEKEKAEVPSYRRNRFQDAEKEREQRKVRESERLEKEK 971 Query: 483 GVHNSTQEEKKT 518 + + E T Sbjct: 972 QERETKERELLT 983 >SB_16838| Best HMM Match : TolA (HMM E-Value=2) Length = 371 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/60 (18%), Positives = 34/60 (56%) Frame = +3 Query: 342 NVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKREKQVKEKGVHNSTQEEKKTQ 521 N N V+ ++ ++ ++ TY I +Q + + ++ ++++KQ +++ Q++++ Q Sbjct: 30 NNSNNVQLQQQKRQQQQKRTYNYDIQQQQKRQQQQQKRQQQKQKRQQQEQKLQQQQRRQQ 89 >SB_14388| Best HMM Match : VHS (HMM E-Value=1.8) Length = 145 Score = 28.3 bits (60), Expect = 6.2 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 2/84 (2%) Frame = +3 Query: 267 KLAAAKRKQNRLISFQNEENEDEGTNVDNVVKER--KYRKHNEETPTYTGGISEQARERL 440 K AA+K+++ + EE E + +ER +YR+ N+E I + ER Sbjct: 17 KKAASKKRRKEQRATAREELERKRQIAREKTRERVRRYRQKNKEEQGQEKKILQNTGERF 76 Query: 441 IERMQKREKQVKEKGVHNSTQEEK 512 R K+ K K T E+K Sbjct: 77 KNRTSKKRVTDKVKDKLPQTPEKK 100 >SB_11504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -2 Query: 690 SFHYHDLFYLCHFYFYPYLYCPHPYLASYLY 598 S++Y+ +Y ++Y+Y Y Y + Y Y Y Sbjct: 2 SYYYYYHYYYYYYYYYYYYYYYYYYYYYYYY 32 >SB_11449| Best HMM Match : RtcR (HMM E-Value=1.9) Length = 335 Score = 28.3 bits (60), Expect = 6.2 Identities = 18/69 (26%), Positives = 28/69 (40%) Frame = +3 Query: 261 LDKLAAAKRKQNRLISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERL 440 LD A R++ + Q +N +E + N + R + NEE I E E Sbjct: 246 LDATANTLREEEERNTEQMRKNNEERSETTNQERLRAIDRKNEELSERNSVIDETLEENQ 305 Query: 441 IERMQKREK 467 +ER E+ Sbjct: 306 LERENLEER 314 >SB_1013| Best HMM Match : Peptidase_M1 (HMM E-Value=0.041) Length = 999 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -3 Query: 338 SFVLVFFVLERYKAILLTFRSSQFIETQ*G 249 +FV VF L RY I +TFRSSQ + + G Sbjct: 912 TFVCVFLPLLRYFVIPVTFRSSQLDKEEGG 941 >SB_56701| Best HMM Match : E-MAP-115 (HMM E-Value=0.63) Length = 936 Score = 28.3 bits (60), Expect = 6.2 Identities = 18/69 (26%), Positives = 28/69 (40%) Frame = +3 Query: 261 LDKLAAAKRKQNRLISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERL 440 LD A R++ + Q +N +E + N + R + NEE I E E Sbjct: 801 LDATANTLREEEERNTEQMRKNNEERSETTNQERLRAIDRKNEELSERNSVIDETLEENQ 860 Query: 441 IERMQKREK 467 +ER E+ Sbjct: 861 LERENLEER 869 >SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) Length = 703 Score = 27.9 bits (59), Expect = 8.2 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 1/82 (1%) Frame = +3 Query: 279 AKRKQNRLISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQK 458 A+RK + L + ++ ++E + +ERK K EE + E+ R+R E +K Sbjct: 212 ARRKADELEKIKRQQEDEERLKNQRLDEERK--KLEEE----EANLMEEERKRKEEAEKK 265 Query: 459 REKQV-KEKGVHNSTQEEKKTQ 521 RE++ K + + Q+ KK + Sbjct: 266 REEEERKRREEEEAAQKWKKEE 287 >SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 27.9 bits (59), Expect = 8.2 Identities = 26/111 (23%), Positives = 46/111 (41%), Gaps = 5/111 (4%) Frame = +3 Query: 210 QKDKPADFQFAKPSLLGLDKLAAAKR---KQNRLISFQNEENEDEGTNVDNVVKERKYRK 380 +K K AKP +L A +R K+ I+ + EE E + K+ + K Sbjct: 108 KKGKAVSVPVAKPKPKSKKQLLAEQRRRAKEMEQIAMELEEKRKEEEEKEKQRKQLEVEK 167 Query: 381 HN--EETPTYTGGISEQARERLIERMQKREKQVKEKGVHNSTQEEKKTQAK 527 EE + + RER + +K++K EK Q+E++ + + Sbjct: 168 QKRLEEERIRSQNEERKRREREQKEREKQQKLDMEKEERRRRQQEEEKKRR 218 >SB_1335| Best HMM Match : E-MAP-115 (HMM E-Value=1.6) Length = 182 Score = 27.9 bits (59), Expect = 8.2 Identities = 18/69 (26%), Positives = 27/69 (39%) Frame = +3 Query: 261 LDKLAAAKRKQNRLISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERL 440 LD R++ + Q +N +E + N + R + NEE I E E Sbjct: 90 LDATGNTLREEEERNTEQMRKNNEERSETTNQERLRAIDRKNEELSERNSVIDETLEENQ 149 Query: 441 IERMQKREK 467 +ER EK Sbjct: 150 LERENLEEK 158 >SB_982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 27.9 bits (59), Expect = 8.2 Identities = 18/58 (31%), Positives = 32/58 (55%) Frame = +3 Query: 315 NEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQARERLIERMQKREKQVKEKGV 488 ++++ED+ + +V ++ + NE TP +G +S ARER RM++R V V Sbjct: 446 DDDDEDDDKSTASVDSDKSLQSANESTP-QSGSMS--ARER--RRMKQRSSDVMSPAV 498 >SB_59039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 27.9 bits (59), Expect = 8.2 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = -2 Query: 690 SFHYHDLFYLCHFYFYPYLYCPHPYLASYLY 598 +++Y+ +Y ++Y+Y Y Y + Y Y Y Sbjct: 17 AYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY 47 >SB_55399| Best HMM Match : C1_4 (HMM E-Value=4.8) Length = 335 Score = 27.9 bits (59), Expect = 8.2 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -2 Query: 690 SFHYHDLFYLCHFYFYPYLYCPHPYLASYLYPD 592 S++Y+ +Y ++Y+Y Y Y + Y Y Y D Sbjct: 265 SYYYYYYYYYYYYYYYYYYY--YYYYYYYYYDD 295 >SB_51335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 576 Score = 27.9 bits (59), Expect = 8.2 Identities = 30/138 (21%), Positives = 56/138 (40%), Gaps = 7/138 (5%) Frame = +3 Query: 126 NCTMTDPEENVHRLEGTSGDTPGGL-IIRQKDKPADFQFAKPSLLGLDKLAAAKRKQNRL 302 N + E EG + D+ + + D+ A + SL + K KRK+ + Sbjct: 78 NADEIEESEKESESEGPASDSEQQENLTKMPDREAIESDSSESLTPVRKRQPQKRKKVQS 137 Query: 303 ISFQNEENEDEGTNVDNVVKERKYRKHNEETPTYTGGISEQ----ARERLIER--MQKRE 464 + +NE+E + ++++K K +T SE+ + + R +K Sbjct: 138 KTNNKSDNEEEDERQEKKIRKQKQEKRKRKTVKADFNSSEEEVSSQKTKASSRKDQKKMN 197 Query: 465 KQVKEKGVHNSTQEEKKT 518 KQ+ KG + +KKT Sbjct: 198 KQMANKG--KGAKSKKKT 213 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,813,295 Number of Sequences: 59808 Number of extensions: 423613 Number of successful extensions: 1678 Number of sequences better than 10.0: 70 Number of HSP's better than 10.0 without gapping: 1286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1531 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -