BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmnc10g09 (699 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36368| Best HMM Match : 14-3-3 (HMM E-Value=0) 225 4e-59 SB_34219| Best HMM Match : No HMM Matches (HMM E-Value=.) 223 1e-58 SB_34217| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 3e-41 SB_37955| Best HMM Match : 14-3-3 (HMM E-Value=6.5861e-44) 147 9e-36 SB_34218| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 33 0.17 SB_42896| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_10602| Best HMM Match : RVT_1 (HMM E-Value=1.3e-10) 30 1.6 SB_42068| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_47927| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) 28 6.3 SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) 28 6.3 SB_12316| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_36368| Best HMM Match : 14-3-3 (HMM E-Value=0) Length = 248 Score = 225 bits (549), Expect = 4e-59 Identities = 114/202 (56%), Positives = 144/202 (71%), Gaps = 3/202 (1%) Frame = +1 Query: 103 PSSTMSVDKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGA 282 P+ +EEL+ AK+AEQAERYDDM AM VT+ G L++EERNLLSVAYKNVVGA Sbjct: 3 PNFVSKCSREELIHLAKMAEQAERYDDMVNAMSAVTKEGKPLNDEERNLLSVAYKNVVGA 62 Query: 283 RRSSWRVISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKAS---N 453 RRSSWRVISS+EQK E + K+YR + EL C +VL +L+ +L+ N Sbjct: 63 RRSSWRVISSMEQK--APEEMAALTKKYREDITNELNGKCAEVLDILENYLLKDGQDDIN 120 Query: 454 PESKVFYLKMKGDYYRYLAEVATGETRHSVVEDSQKAYQDAFEISKAKMQPTHPIRLGLA 633 E+KVFYLKM+GDY+RYL EVA G++R +E S++AY+DA ++ P+HPIRLGLA Sbjct: 121 TEAKVFYLKMRGDYHRYLVEVAEGDSRKENIEKSREAYKDA-SAKAEELSPSHPIRLGLA 179 Query: 634 LNFSVFYYEILNSPDKACQLAK 699 LNFSVFYYEI N P +AC+LAK Sbjct: 180 LNFSVFYYEIENKPPEACKLAK 201 >SB_34219| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 309 Score = 223 bits (545), Expect = 1e-58 Identities = 113/174 (64%), Positives = 129/174 (74%), Gaps = 2/174 (1%) Frame = +1 Query: 184 MAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSERKQQMAKE 363 MA AMKE TE L EERNLLSVAYKNVVGA+RSSWRVISSIEQK EGSERK+Q + Sbjct: 1 MAKAMKEATEISETLEQEERNLLSVAYKNVVGAKRSSWRVISSIEQKLEGSERKKQNTET 60 Query: 364 YRVKVEKELREICYDVLGLLDKHLIPKASNPESKVFYLKMKGDYYRYLAEVATGETRHSV 543 YR +E EL E+C VL LL+ LIP A + ESKVFYLKMKGDYYRY EVA + R V Sbjct: 61 YRQTIENELNEVCETVLKLLESKLIPNAQSTESKVFYLKMKGDYYRYEGEVAGADRRREV 120 Query: 544 VEDSQKAYQDAFEISK--AKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAK 699 V+ + KAY +A EI++ K+ PT PIRLGLALNFSVFYYEI+ +AC LAK Sbjct: 121 VQKAMKAYSEAQEIAEKDPKLPPTDPIRLGLALNFSVFYYEIVEDSKQACDLAK 174 Score = 62.9 bits (146), Expect = 2e-10 Identities = 31/57 (54%), Positives = 44/57 (77%), Gaps = 3/57 (5%) Frame = +1 Query: 538 SVVEDSQKAYQDAFEISKA---KMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAK 699 +VVE + +AY++A E ++ K+ PT PIRLGLALNFSVF+YEI + ++AC+LAK Sbjct: 207 TVVEKALQAYKEAKEAAETGDGKLAPTDPIRLGLALNFSVFHYEIQENQEEACKLAK 263 >SB_34217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 165 bits (401), Expect = 3e-41 Identities = 81/138 (58%), Positives = 107/138 (77%) Frame = +1 Query: 115 MSVDKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSS 294 M V +E L+ AKL+EQ +RYD+MA MKEV+E +LS EERNLLSV+YKN+VG RRSS Sbjct: 80 MMVVRETLIYNAKLSEQCDRYDEMAKIMKEVSEKYPKLSKEERNLLSVSYKNIVGQRRSS 139 Query: 295 WRVISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKASNPESKVFY 474 WRVISSIE+KT S + K+Y+ +EKEL+++C +VLG+L++ LIP A + E+KVFY Sbjct: 140 WRVISSIEEKTAESS-SLAIVKKYKACIEKELKDLCKEVLGILER-LIPGAEDEENKVFY 197 Query: 475 LKMKGDYYRYLAEVATGE 528 K+KGDYYRYLAE + G+ Sbjct: 198 FKLKGDYYRYLAEFSHGQ 215 >SB_37955| Best HMM Match : 14-3-3 (HMM E-Value=6.5861e-44) Length = 251 Score = 147 bits (356), Expect = 9e-36 Identities = 75/123 (60%), Positives = 93/123 (75%), Gaps = 3/123 (2%) Frame = +1 Query: 124 DKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSSWRV 303 DKEE V AKLAEQAERYDDM +MKEV + G ELS E+RNLLSVAYKNV+GARR+SWR+ Sbjct: 3 DKEEHVYMAKLAEQAERYDDMVNSMKEVAKMGTELSTEDRNLLSVAYKNVIGARRASWRI 62 Query: 304 ISSIEQKTE--GSE-RKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKASNPESKVFY 474 I+SIEQK E G + K +M + YR +E+EL+ IC ++L LLD LI + + ESKVFY Sbjct: 63 ITSIEQKEESKGEDMAKLEMIRNYRKTIEEELKTICGEILSLLDDSLIKNSQSEESKVFY 122 Query: 475 LKM 483 K+ Sbjct: 123 NKI 125 >SB_34218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 607 Score = 83.0 bits (196), Expect = 2e-16 Identities = 43/102 (42%), Positives = 63/102 (61%), Gaps = 2/102 (1%) Frame = +1 Query: 115 MSVDKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSS 294 M + ELVQ AKLAEQ ER++D+ MK+ E L+ E RNLLSV YKNVVG++R + Sbjct: 186 MQDSRNELVQLAKLAEQTERFEDVILYMKKAIEINPSLNKEHRNLLSVGYKNVVGSKRFA 245 Query: 295 WRVISSIEQKTEGSERKQQMAK--EYRVKVEKELREICYDVL 414 WR + ++ R Q+ +Y+ K+E EL+ +C ++L Sbjct: 246 WRHLHHDALQSGRYIRDSQLKGIIKYKEKIEMELKTLCREIL 287 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 33.5 bits (73), Expect = 0.17 Identities = 23/86 (26%), Positives = 40/86 (46%) Frame = +1 Query: 127 KEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGARRSSWRVI 306 KE+ AK ++ ER + A K+ E + EE++ L K R+ + Sbjct: 339 KEKERLEAKQKKEQERLEKQAEKEKKEKERLEKKQREEKDRLEKKEKKEEEKRKKEEEIN 398 Query: 307 SSIEQKTEGSERKQQMAKEYRVKVEK 384 + IE+K + E+K+Q +E K E+ Sbjct: 399 AKIEEKKKREEKKKQEEEEKMKKKEQ 424 >SB_42896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 994 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = +1 Query: 91 ISPLPSSTMSVDKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEER 243 +SPLPS+ +E+V KLAE+ E ++++ T+ E + EE+ Sbjct: 643 VSPLPSTATEDQMQEVVDSNKLAEKKEVTEEVSPVKPLSTKESKENALEEK 693 >SB_10602| Best HMM Match : RVT_1 (HMM E-Value=1.3e-10) Length = 416 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/62 (25%), Positives = 31/62 (50%) Frame = +1 Query: 409 VLGLLDKHLIPKASNPESKVFYLKMKGDYYRYLAEVATGETRHSVVEDSQKAYQDAFEIS 588 +LGL++ H+ PK+ + ++F +Y+ +L V T+ +E + Y + S Sbjct: 116 ILGLIESHIDPKSFH--HRMFLAACCLEYFGFLRSVEFTVTQEKCIEQNMPLYAVFIDFS 173 Query: 589 KA 594 KA Sbjct: 174 KA 175 >SB_42068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3367 Score = 29.9 bits (64), Expect = 2.1 Identities = 28/121 (23%), Positives = 55/121 (45%), Gaps = 12/121 (9%) Frame = +1 Query: 112 TMSVDKEELVQRAKLAEQAERY---DDMAAAMKEVTETGVELSNE-ERNLLSVAYKNVVG 279 ++S+ +EL + LA Q + D A K+VT ++ + E R + + Sbjct: 3123 SLSLKSQELEAKNALANQKLKQMVKDQQEAEKKKVTSMEIQTTIETHRKQTIIEMVSCAA 3182 Query: 280 ARRSSWR--------VISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHL 435 R S++ + SS++++T+ + KQQ + +VE + E V G+ +HL Sbjct: 3183 CLRKSYQESAFLDLLITSSLQKQTKQIKEKQQAVMKDLAQVEPAVDEARQAVKGIKKQHL 3242 Query: 436 I 438 + Sbjct: 3243 V 3243 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 29.5 bits (63), Expect = 2.7 Identities = 22/100 (22%), Positives = 52/100 (52%), Gaps = 3/100 (3%) Frame = +1 Query: 103 PSSTMSVDKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLL-SVAYKNVVG 279 PSS S DK+E+ +++ +++++ ++A K + E ++S + S+ K + Sbjct: 1066 PSSRSSHDKDEISEKSNPSDKSD--VEVARKNKHMPEALYKISETISGMNDSITLKEPLK 1123 Query: 280 ARRSSWR--VISSIEQKTEGSERKQQMAKEYRVKVEKELR 393 A+ R ++ + E +R+ + K++R++ EK+ R Sbjct: 1124 AKDGDGRNKEEQELKDRMENEKREDTIRKQHRLQWEKKAR 1163 >SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1234 Score = 29.5 bits (63), Expect = 2.7 Identities = 27/115 (23%), Positives = 52/115 (45%), Gaps = 6/115 (5%) Frame = +1 Query: 127 KEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVGAR------R 288 ++ L + K A +R +A+A+ + + + LS K VV + + Sbjct: 279 QKTLSEMFKQAVTEDRPKMLASAITKALNQDIHSPSALNLPLSTPAKQVVKTKWDRIREK 338 Query: 289 SSWRVISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKASN 453 W ++S E+ +ER++Q E +VK E++ R+ ++ + HL K SN Sbjct: 339 HQWNLLSEDEKNKIKAERRKQKRLELKVKREEKERKRLEELKRVSFAHLGMKLSN 393 >SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4924 Score = 28.7 bits (61), Expect = 4.8 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = +1 Query: 517 ATGETRHS-VVEDSQKAYQDAFEISKAKMQPTHPIRLGLALNFSVFYYEILNS 672 A GETR + D+ +A +D KA+ Q + ALN S+F++E++NS Sbjct: 4020 ALGETRRKRSLVDTPEANED-----KAQHQVPDAEKCQFALNASLFFFEVINS 4067 >SB_47927| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) Length = 512 Score = 28.3 bits (60), Expect = 6.3 Identities = 20/85 (23%), Positives = 43/85 (50%), Gaps = 1/85 (1%) Frame = +1 Query: 145 RAKLAEQAERYDDMAAAM-KEVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQ 321 + K+ +++E+YD + + KE T+ G + E + N AR + ++ + Sbjct: 13 KRKIFKKSEKYDRLEEPLEKEGTDGGEIEAEAEVEPHTEEEANYNEARSENCEKNNNNDS 72 Query: 322 KTEGSERKQQMAKEYRVKVEKELRE 396 T ++ +Q KE+ V +EK+L++ Sbjct: 73 STPDAKSQQADIKEWIVSLEKQLKD 97 >SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1126 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +1 Query: 298 RVISSIEQKTEGSERKQQMAKEYRVKVEKELREIC 402 R++ IE+K E E ++ AKE + + E+E + IC Sbjct: 919 RIMKEIEEK-EKKEEAERKAKEEKEREERERKRIC 952 >SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) Length = 783 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +1 Query: 343 KQQMAKEYRVKVEKELREICYDVLGLLDKHLIPK 444 K++M ++Y K+EKE+ Y+++ L K ++ K Sbjct: 292 KEEMKEKYDGKIEKEMSGAIYEIISRLMKAVVGK 325 >SB_12316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 27.9 bits (59), Expect = 8.4 Identities = 26/99 (26%), Positives = 47/99 (47%) Frame = +1 Query: 100 LPSSTMSVDKEELVQRAKLAEQAERYDDMAAAMKEVTETGVELSNEERNLLSVAYKNVVG 279 L S+ +D+E R +++++ RY + A MK V E + ++E + + Sbjct: 539 LDSNLSKLDQEVRGLREEISQEESRYHYLHAMMK-VLEIQQKRIDDEMKAYTAQDQ---A 594 Query: 280 ARRSSWRVISSIEQKTEGSERKQQMAKEYRVKVEKELRE 396 R+ SWR EQ T + ++ + K R K +K +RE Sbjct: 595 DRKKSWR-----EQYTRKIQEQENLGKSLREK-QKAVRE 627 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,883,311 Number of Sequences: 59808 Number of extensions: 440793 Number of successful extensions: 1270 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1169 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1263 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -